Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18370 47 / 2e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G15050 46 / 7e-08 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT2G38540 44 / 2e-07 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT5G59310 42 / 2e-06 LTP4 lipid transfer protein 4 (.1) AT5G01870 38 / 7e-05 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G59320 37 / 0.0001 LTP3 lipid transfer protein 3 (.1) AT2G38530 37 / 0.0002 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086600 [exp] 42 / 2e-06 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086500 [exp] 42 / 3e-06 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.001G232700 [exp] 41 / 5e-06 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G025200 [exp] 40 / 1e-05 AT2G18370 86 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232900 [exp] 39 / 3e-05 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G136000 [exp] 39 / 5e-05 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G098000 [exp] 37 / 0.0002 AT5G59310 71 / 9e-17 lipid transfer protein 4 (.1) Potri.014G046500 [exp] 37 / 0.0003 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.016G135800 [exp] 36 / 0.0005 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001703 [exp] 46 / 6e-08 AT4G33355 86 / 9e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10023087 [exp] 42 / 3e-06 AT4G33355 69 / 8e-16 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10025148 [exp] 42 / 4e-06 AT5G01870 105 / 6e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032381 [exp] 42 / 4e-06 AT5G62050 270 / 4e-87 HOMOLOG OF YEAST OXIDASE ASSEMBLY 1 \(OXA1\) IN ARABIDOPSIS THALIANA, ARABIDOPSIS THALIANA HOMOLOG OF YEAST OXIDASE ASSEMBLY 1 \(OXA1\), homolog of yeast oxidase assembly 1 (OXA1) (.1) Lus10015279 [exp] 41 / 5e-06 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10025230 [exp] 41 / 7e-06 AT3G08770 105 / 4e-30 lipid transfer protein 6 (.1.2) Lus10042210 [exp] 40 / 9e-06 AT5G59320 86 / 6e-23 lipid transfer protein 3 (.1) Lus10022744 [exp] 40 / 1e-05 AT2G38540 86 / 1e-22 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Lus10003884 [exp] 39 / 3e-05 AT4G33355 72 / 6e-17 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10001829 [exp] 39 / 3e-05 AT4G33355 81 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.003G139850.1 pacid=42785716 polypeptide=Potri.003G139850.1.p locus=Potri.003G139850 ID=Potri.003G139850.1.v4.1 annot-version=v4.1 ATGGTTTTAGCCACTCTCTTGATGGTTTTTGTGCCAGCCTCGGAGACAAGTAGCGCACCATGTTCTTGCGGCGAGGTGAACTACCAATTGAACCCATGTA TTTCTTACCTAGTGAAAACCATGGCTGAGCCACCCAAGGTATGTTGTGATGGCATTAAGCGTCTATCCAAGTATTCAAACAAAAAGAAAAATAGAGAGAT TGTGCCTTGA
AA sequence Show only first row Show all	>Potri.003G139850.1 pacid=42785716 polypeptide=Potri.003G139850.1.p locus=Potri.003G139850 ID=Potri.003G139850.1.v4.1 annot-version=v4.1 MVLATLLMVFVPASETSSAPCSCGEVNYQLNPCISYLVKTMAEPPKVCCDGIKRLSKYSNKKKNREIVP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G18370			Bifunctional inhibitor/lipid-t...		Potri.003G139850 [exp]	0	1
AT2G29670			Tetratricopeptide repeat (TPR)...		Potri.001G250100 [exp]	3.00	0.9146
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Potri.004G023964 [exp]	7.34	0.9116
AT4G20800			FAD-binding Berberine family p...		Potri.001G459200 [exp]	8.77	0.8947
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Potri.004G024000 [exp]	9.32	0.9105
AT1G75430	HD	BLH11	BEL1-like homeodomain 11 (.1)		Potri.005G232000 [exp]	10.48	0.9016
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Potri.010G010100 [exp]	12.64	0.9034
AT3G21240		AT4CL2, 4CL2	4-coumarate:CoA ligase 2 (.1)		Potri.018G094200 [exp]	14.83	0.8599	4CL1.4
AT2G47490		ATNDT1	NAD+ transporter 1, ARABIDOPSI...		Potri.002G200900 [exp]	18.16	0.8477
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Potri.004G023700 [exp]	24.39	0.8652
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Potri.004G024140 [exp]	25.09	0.8709

Compare expression of checked genes

Potri.003G139850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.