Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23930 176 / 3e-56 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) AT1G64450 166 / 2e-50 Glycine-rich protein family (.1) AT2G46150 45 / 9e-06 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT3G54200 42 / 0.0001 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT2G01080 39 / 0.0008 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G090400 [exp] 311 / 5e-109 AT4G23930 166 / 2e-52 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.003G133400 [exp] 62 / 2e-11 AT2G46150 164 / 7e-51 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.001G098100 [exp] 56 / 1e-09 AT2G46150 171 / 2e-53 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G112700 [exp] 56 / 2e-09 AT3G05975 127 / 6e-37 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.016G142300 [exp] 51 / 7e-08 AT3G54200 162 / 3e-50 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.006G112800 [exp] 50 / 9e-08 AT3G54200 159 / 7e-49 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.002G165100 [exp] 48 / 1e-06 AT2G46150 184 / 1e-58 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.001G098200 [exp] 44 / 1e-05 AT1G64065 102 / 2e-27 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.012G145500 [exp] 40 / 0.0006 AT5G36970 238 / 2e-78 NDR1/HIN1-like 25 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023071 [exp] 220 / 2e-73 AT1G64450 191 / 3e-62 Glycine-rich protein family (.1) Lus10003189 [exp] 180 / 4e-56 AT1G64450 158 / 7e-48 Glycine-rich protein family (.1) Lus10032397 [exp] 109 / 5e-31 AT4G23930 85 / 2e-22 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Lus10001818 [exp] 97 / 3e-25 AT1G64450 86 / 4e-20 Glycine-rich protein family (.1) Lus10018185 [exp] 51 / 7e-08 AT3G54200 153 / 9e-47 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10006764 [exp] 50 / 2e-07 AT3G54200 79 / 5e-18 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10025649 [exp] 50 / 2e-07 AT3G54200 152 / 2e-46 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10007649 [exp] 49 / 5e-07 AT3G54200 85 / 2e-20 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10018361 [exp] 49 / 6e-07 AT3G54200 91 / 1e-22 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10040941 [exp] 49 / 7e-07 AT3G54200 63 / 1e-11 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0159 [poplar] [flax] E-set PF03168 [poplar] [flax] LEA_2 Late embryogenesis abundant protein
Representative CDS sequence Show only first row Show all	>Potri.003G141200.1 pacid=42786248 polypeptide=Potri.003G141200.1.p locus=Potri.003G141200 ID=Potri.003G141200.1.v4.1 annot-version=v4.1 ATGAGCAAACCACACAGACCACCTTCCGGGCGCACAAATCTTGCTTCGTGCATAGTGGCTACAATCTTCTTAATCTTCCTTGTTATCATAATCCTTATTG TCTTCTTCACTGTTTTCAAGCCTAAAGATCCTAAAATCTCTGTTAACTCTGTTCAACTTCCATCATTTTCTGTCTCTAACAACACTGTTAACTTCACTTT CTCTCAATATGTCTCCGTCAAGAACCCAAATAGAGCTGTTTTTTCTCACTTTGATAGTACCCTTCAGCTTCTTTACTCGGGTTCTCAAATCGGGTTCATG TTCATACCTGCTGGTAAAATTGATGCGGGTCGAACCCAGTACATGGCCGCTACCTTTTCTGTTGAGTCTTTCCCTTTATCTGCTTCGCCGGATGCAGCGG TCAATGTGGGACCCGCGTTCAATGACGGTGGGTTTGGCGGTGGTGGACAAACCGGTTTTAACAATGGGTATCGGGTCGGACCTACGATGGAGATAGAGTC AAGAATTCAAATGGCGGGTCGGGTTCGCGTCTTGCATTTTTTTACCCATCATTTGGAGACTAAAGTTGGATGCAGGGTTGTCATTGCTGTGAGTGATGGA TCTGTTTTAGGGTTTCATTGCTAG
AA sequence Show only first row Show all	>Potri.003G141200.1 pacid=42786248 polypeptide=Potri.003G141200.1.p locus=Potri.003G141200 ID=Potri.003G141200.1.v4.1 annot-version=v4.1 MSKPHRPPSGRTNLASCIVATIFLIFLVIIILIVFFTVFKPKDPKISVNSVQLPSFSVSNNTVNFTFSQYVSVKNPNRAVFSHFDSTLQLLYSGSQIGFM FIPAGKIDAGRTQYMAATFSVESFPLSASPDAAVNVGPAFNDGGFGGGGQTGFNNGYRVGPTMEIESRIQMAGRVRVLHFFTHHLETKVGCRVVIAVSDG SVLGFHC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G23930			Late embryogenesis abundant (L...		Potri.003G141200 [exp]	0	1
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Potri.015G057800 [exp]	4.12	0.8531
AT5G45780			Leucine-rich repeat protein ki...		Potri.004G059100 [exp]	4.47	0.8256
AT5G02560		HTA12	histone H2A 12 (.1.2)		Potri.006G082300 [exp]	6.48	0.8003
AT5G11590	AP2_ERF	DREB3, TINY2	TINY2, Integrase-type DNA-bind...		Potri.018G043900 [exp]	7.74	0.7886
					Potri.014G192701 [exp]	15.29	0.8125
AT5G05830			RING/FYVE/PHD zinc finger supe...		Potri.009G039700 [exp]	16.24	0.7823
AT1G07790		HTB1	Histone superfamily protein (....		Potri.010G231300 [exp]	20.37	0.8054
AT3G58690			Protein kinase superfamily pro...		Potri.014G143100 [exp]	20.78	0.7988
AT1G25520			Uncharacterized protein family...		Potri.019G116100 [exp]	23.40	0.8121
AT5G01225			unknown protein		Potri.016G112700 [exp]	24.04	0.7855

Compare expression of checked genes

Potri.003G141200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.