Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G23990 64 / 2e-13 ATCSLG3 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE G3, cellulose synthase like G3 (.1) AT4G24000 64 / 2e-13 ATCSLG2 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE LIKE G2, cellulose synthase like G2 (.1) AT1G55850 54 / 6e-10 ATCSLE1 cellulose synthase like E1 (.1) AT4G24010 54 / 8e-10 CSLG2, ATCSLG1 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE LIKE G1, cellulose synthase like G1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G142500 [exp] 154 / 2e-45 AT4G23990 809 / 0.0 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE G3, cellulose synthase like G3 (.1) Potri.003G142400 [exp] 144 / 1e-41 AT4G23990 850 / 0.0 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE G3, cellulose synthase like G3 (.1) Potri.001G369100 [exp] 40 / 3e-05 AT1G55850 887 / 0.0 cellulose synthase like E1 (.1) Potri.006G004300 [exp] 40 / 4e-05 AT1G55850 762 / 0.0 cellulose synthase like E1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032415 [exp] 72 / 2e-16 AT4G23990 813 / 0.0 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE G3, cellulose synthase like G3 (.1) Lus10023056 [exp] 72 / 3e-16 AT4G23990 776 / 0.0 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE G3, cellulose synthase like G3 (.1) Lus10023057 [exp] 69 / 3e-15 AT4G23990 816 / 0.0 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE G3, cellulose synthase like G3 (.1) Lus10003196 [exp] 66 / 4e-14 AT4G23990 815 / 0.0 ARABIDOPSIS THALIANA CELLULOSE SYNTHASE-LIKE G3, cellulose synthase like G3 (.1) Lus10016625 [exp] 41 / 3e-05 AT1G55850 801 / 0.0 cellulose synthase like E1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.003G142301.1 pacid=42786455 polypeptide=Potri.003G142301.1.p locus=Potri.003G142301 ID=Potri.003G142301.1.v4.1 annot-version=v4.1 ATGTTTGTCTCCCTAACATTGGCGGCCATAATTAATTTAATCTCATTTTCCCAAGGGCTTGTTGAAGTTTTCAGAGGAAACAATTTGGAGGGACTATTCG TGCAGATGTTCATATCTGGTTTTGCTGTGGTGAATTCTTGGCCAATTTACGAAGCCATAGCTTTGAGAAATGACAATGGGAAAATGCCTGTCAAAACCAC CATTATGGCAACACTTCTGGCAGGTGCATTCTATGCAGCATCTTCTTTCATCTGCAGGTAA
AA sequence Show only first row Show all	>Potri.003G142301.1 pacid=42786455 polypeptide=Potri.003G142301.1.p locus=Potri.003G142301 ID=Potri.003G142301.1.v4.1 annot-version=v4.1 MFVSLTLAAIINLISFSQGLVEVFRGNNLEGLFVQMFISGFAVVNSWPIYEAIALRNDNGKMPVKTTIMATLLAGAFYAASSFICR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G23990		ATCSLG3	ARABIDOPSIS THALIANA CELLULOSE...		Potri.003G142301 [exp]	0	1
AT3G21760		HYR1	HYPOSTATIN RESISTANCE 1, UDP-G...		Potri.016G017232 [exp]	2.00	0.9747
AT3G21760		HYR1	HYPOSTATIN RESISTANCE 1, UDP-G...		Potri.016G017166 [exp]	2.44	0.9668
AT5G65660			hydroxyproline-rich glycoprote...		Potri.019G055500 [exp]	3.74	0.9528
AT1G02260			Divalent ion symporter (.1)		Potri.017G141700 [exp]	4.47	0.9573
AT3G17650		YSL5, PDE321	pigment defective 321, YELLOW ...		Potri.017G151232 [exp]	5.47	0.9558
AT1G66200		ATGSR2, GLN1;2	glutamine synthetase 1;2, glut...		Potri.004G085400 [exp]	9.48	0.9518	Pt-CYTGS.4
AT4G36530			alpha/beta-Hydrolases superfam...		Potri.005G121000 [exp]	11.00	0.9485
AT4G14880		OLD3, CYTACS1, ...	ONSET OF LEAF DEATH 3, O-acety...		Potri.008G153300 [exp]	11.83	0.9377
AT1G65730		YSL7	YELLOW STRIPE like 7 (.1)		Potri.017G151800 [exp]	12.84	0.9419
AT3G57680			Peptidase S41 family protein (...		Potri.006G055400 [exp]	13.41	0.9481

Compare expression of checked genes

Potri.003G142301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.