Potri.003G143250 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.003G143250.1 pacid=42786190 polypeptide=Potri.003G143250.1.p locus=Potri.003G143250 ID=Potri.003G143250.1.v4.1 annot-version=v4.1
ATGGCAAGACTCGTGCAAATTCACCAAGTGAGGCCATATATAGCTGAGATGGAGATGAAGAAGCTAACAGAGACCGCAGAGGAACAGGGCTATTATTGCC
GTGGCGAGCCTGAACACGAACAACGAAGATTTCGTGGTGTTGGTGACATCTCTCGCTGCTGA
AA sequence
>Potri.003G143250.1 pacid=42786190 polypeptide=Potri.003G143250.1.p locus=Potri.003G143250 ID=Potri.003G143250.1.v4.1 annot-version=v4.1
MARLVQIHQVRPYIAEMEMKKLTETAEEQGYYCRGEPEHEQRRFRGVGDISRC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.003G143250 0 1
AT4G36490 ATSFH12 SEC14-like 12 (.1) Potri.007G020300 8.94 0.9684 Pt-LJPLP.1
AT3G61230 LIM PLIM2c PLIM2c, GATA type zinc finger ... Potri.001G107100 12.24 0.9650
Potri.006G009300 16.79 0.9632
AT5G41990 EIP1, ATWNK8, W... EMF1-Interacting Protein 1, wi... Potri.003G145300 21.63 0.9567 WNK8.3
AT5G05130 DNA/RNA helicase protein (.1) Potri.016G033700 22.18 0.9185
AT1G77410 BGAL16 beta-galactosidase 16 (.1) Potri.002G080700 24.95 0.9373
Potri.001G112250 27.38 0.9181
AT5G05800 unknown protein Potri.014G061450 29.54 0.9623
Potri.009G020201 31.14 0.9623
AT5G52640 AtHsp90-1, ATHS... HEAT SHOCK PROTEIN 83, HEAT SH... Potri.003G131925 35.32 0.9275

Potri.003G143250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.