Potri.003G143300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G087701 77 / 2e-20 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.003G143300.1 pacid=42786786 polypeptide=Potri.003G143300.1.p locus=Potri.003G143300 ID=Potri.003G143300.1.v4.1 annot-version=v4.1
ATGGGTTCTCAGACCAAAACTATTCTTCTCATCCTCCTCCTCCTCTTCATTGATTTATCTGCAGGTGAATTTTCAGGCATCCAGGAGGGCCATATTCTGC
CAAATCCACCAAGTGAGCTCATTTATGAAGTGGAGATGAGAAAGCTCACAGAGATGGAGGCTATGGTGGACTACCAAAAAGATCCGGTGCCTAATCCTAA
ACACGAACCACACCCCTGA
AA sequence
>Potri.003G143300.1 pacid=42786786 polypeptide=Potri.003G143300.1.p locus=Potri.003G143300 ID=Potri.003G143300.1.v4.1 annot-version=v4.1
MGSQTKTILLILLLLFIDLSAGEFSGIQEGHILPNPPSELIYEVEMRKLTEMEAMVDYQKDPVPNPKHEPHP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.003G143300 0 1
AT5G53486 unknown protein Potri.012G017400 5.65 0.8450
Potri.014G061266 6.08 0.6686
AT5G66350 SHI SHORT INTERNODES, Lateral root... Potri.009G121600 6.24 0.8113
AT3G08720 ATPK2, ATPK19, ... ARABIDOPSIS THALIANA SERINE/TH... Potri.019G061800 7.34 0.7613
AT5G19820 EMB2734 embryo defective 2734, ARM rep... Potri.007G084100 7.74 0.7883
AT3G22210 unknown protein Potri.016G018650 21.16 0.6731
Potri.001G286150 21.21 0.5725
AT5G19820 EMB2734 embryo defective 2734, ARM rep... Potri.007G084501 22.91 0.6893
AT5G23960 ATTPS21 terpene synthase 21 (.1.2) Potri.019G016400 38.88 0.6401
ATCG01090 ATCG01090.1, ND... NADPH dehydrogenases (.1) Potri.013G074950 41.15 0.7591

Potri.003G143300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.