Potri.003G144600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G42000 281 / 8e-99 ORMDL family protein (.1.2)
AT1G01230 265 / 1e-92 ORMDL family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G086300 306 / 1e-108 AT5G42000 273 / 1e-95 ORMDL family protein (.1.2)
Potri.002G174400 275 / 1e-96 AT1G01230 254 / 3e-88 ORMDL family protein (.1)
Potri.014G101000 274 / 6e-96 AT1G01230 285 / 3e-100 ORMDL family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033219 283 / 1e-99 AT5G42000 271 / 5e-95 ORMDL family protein (.1.2)
Lus10023031 282 / 2e-99 AT5G42000 270 / 1e-94 ORMDL family protein (.1.2)
Lus10005980 273 / 1e-95 AT1G01230 295 / 1e-104 ORMDL family protein (.1)
Lus10030232 259 / 7e-83 AT1G09880 661 / 0.0 Rhamnogalacturonate lyase family protein (.1)
Lus10003209 200 / 1e-67 AT5G42000 194 / 2e-65 ORMDL family protein (.1.2)
Lus10017314 197 / 1e-65 AT5G42000 197 / 3e-66 ORMDL family protein (.1.2)
Lus10031614 81 / 3e-20 AT2G40190 81 / 1e-20 LEAF WILTING 3, UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04061 ORMDL ORMDL family
Representative CDS sequence
>Potri.003G144600.1 pacid=42785801 polypeptide=Potri.003G144600.1.p locus=Potri.003G144600 ID=Potri.003G144600.1.v4.1 annot-version=v4.1
ATGTACGTTAAAGCTGAGCCAACGACAGATGTGAATAGGAACACGGAGTGGTTCACATATCCTGGAGTTTGGACCACTTATATGCTCATCGTTTTCATGT
CATGGCTCCTTGTTCTTTCCATCTTTGGTTGTTCTCCTGGGATGGCTTGGACTATTGTCCATTTCTGTCATTTCGCTGTTACATATCACTTTTTTCACTG
GAAGAAGGGAACTCCCTTTGCTGATGACCAGGGTATCTACAATGGATTGACTTGGTGGGAGCAAATAGAAAATGGCAAGCAACTCACACGCAACAGGAAG
TTTCTGACCGTTGTGCCTGTAGTGCTGTATTTGATAGCCTCGCACACAACAGACTATCAAAATCCAATGCTCTTCTTCAACACATTGGCTGTATTTGTGC
TGGTTGTTGCTAAGTTCCCAAACATGCACAAGGTTCGCATATTCGGAATCAATGCTGATCATTGA
AA sequence
>Potri.003G144600.1 pacid=42785801 polypeptide=Potri.003G144600.1.p locus=Potri.003G144600 ID=Potri.003G144600.1.v4.1 annot-version=v4.1
MYVKAEPTTDVNRNTEWFTYPGVWTTYMLIVFMSWLLVLSIFGCSPGMAWTIVHFCHFAVTYHFFHWKKGTPFADDQGIYNGLTWWEQIENGKQLTRNRK
FLTVVPVVLYLIASHTTDYQNPMLFFNTLAVFVLVVAKFPNMHKVRIFGINADH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G42000 ORMDL family protein (.1.2) Potri.003G144600 0 1
AT2G31200 ADF6, ATADF6 actin depolymerizing factor 6 ... Potri.002G038800 6.00 0.7907 Pt-ADF6.3
AT4G20410 GAMMA-SNAP, GSN... gamma-soluble NSF attachment p... Potri.001G440600 10.58 0.8197 Pt-GSNAP.2
AT5G45130 ATRAB-F2A, RHA1... ARABIDOPSIS RAB HOMOLOG F2A, R... Potri.015G113000 12.64 0.7747 ARA7.2
AT5G55190 RAN3, ATRAN3 RAN GTPase 3 (.1) Potri.006G250400 16.43 0.7707 Pt-RAN1.1
AT2G40020 Nucleolar histone methyltransf... Potri.010G190800 17.20 0.7335
AT5G59890 ADF4, ATADF4 actin depolymerizing factor 4 ... Potri.008G052100 18.00 0.7777
AT5G16450 Ribonuclease E inhibitor RraA/... Potri.019G053800 20.24 0.7304
AT2G38710 AMMECR1 family (.1.2) Potri.010G240000 30.04 0.6851
AT4G33410 ATSPPL1 SIGNAL PEPTIDE PEPTIDASE-LIKE ... Potri.012G142400 54.86 0.7621
AT5G57860 Ubiquitin-like superfamily pro... Potri.006G181400 62.96 0.7156

Potri.003G144600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.