Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12560 113 / 7e-28 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) AT4G22390 95 / 2e-21 F-box associated ubiquitination effector family protein (.1) AT3G06240 84 / 9e-18 F-box family protein (.1) AT3G07870 82 / 4e-17 F-box and associated interaction domains-containing protein (.1) AT3G23880 81 / 1e-16 F-box and associated interaction domains-containing protein (.1) AT1G47790 80 / 2e-16 F-box and associated interaction domains-containing protein (.1) AT3G21130 74 / 2e-14 F-box and associated interaction domains-containing protein (.1) AT3G16210 73 / 5e-14 F-box family protein (.1) AT3G10240 71 / 2e-13 F-box and associated interaction domains-containing protein (.1) AT1G50870 71 / 2e-13 F-box and associated interaction domains-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G006900 [exp] 401 / 2e-138 AT4G12560 95 / 3e-21 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.008G006800 [exp] 391 / 3e-135 AT4G12560 100 / 4e-23 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.010G207500 [exp] 214 / 3e-66 AT4G12560 94 / 3e-21 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.001G262900 [exp] 145 / 4e-40 AT4G12560 107 / 5e-26 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.011G121200 [exp] 142 / 7e-39 AT4G12560 116 / 9e-29 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.001G318300 [exp] 118 / 7e-30 AT3G06240 140 / 7e-38 F-box family protein (.1) Potri.017G058900 [exp] 115 / 1e-28 AT3G06240 132 / 2e-34 F-box family protein (.1) Potri.001G318400 [exp] 105 / 2e-25 AT3G06240 142 / 3e-38 F-box family protein (.1) Potri.008G215800 [exp] 105 / 7e-25 AT3G07870 101 / 3e-23 F-box and associated interaction domains-containing protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038606 [exp] 128 / 2e-33 AT3G07870 112 / 1e-27 F-box and associated interaction domains-containing protein (.1) Lus10037892 [exp] 128 / 3e-33 AT3G06240 107 / 7e-26 F-box family protein (.1) Lus10038603 [exp] 124 / 1e-31 AT3G06240 110 / 2e-26 F-box family protein (.1) Lus10013873 [exp] 111 / 2e-27 AT3G06240 104 / 2e-24 F-box family protein (.1) Lus10026587 [exp] 107 / 1e-25 AT3G06240 104 / 3e-24 F-box family protein (.1) Lus10008871 [exp] 94 / 7e-21 AT4G12560 135 / 1e-35 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10039024 [exp] 93 / 1e-20 AT4G12560 333 / 3e-111 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10013872 [exp] 92 / 1e-20 AT3G06240 101 / 2e-23 F-box family protein (.1) Lus10023238 [exp] 90 / 1e-19 AT3G23880 126 / 6e-33 F-box and associated interaction domains-containing protein (.1) Lus10001105 [exp] 89 / 3e-19 AT3G06240 109 / 3e-26 F-box family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [poplar] [flax] F-box PF00646 [poplar] [flax] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Potri.003G145950.1 pacid=42787482 polypeptide=Potri.003G145950.1.p locus=Potri.003G145950 ID=Potri.003G145950.1.v4.1 annot-version=v4.1 ATGACAGGAGTGGCGAAGGATTCTATTACGAAAGATATGGTGATGCAGATTCTCTTAAAATTACCCGTCAAATCTATGTTGAGATTCAGGTGTGCATCAA AATCATGGAACTCCCTCGTTACTAGCCCTGGCTTCATGAAGAACCATCTGGACAAAGCCAAACAACTGCTTCTCCTTCGAACCGAAAATCCTGTAGTATC TTACTCTTTGCATCTTGATAATGATCGTGTAGATATGCGCTCACGTTTGGAGTTTCCTATTCCGAATGAAGCTGGTCTTTTTTTGATTTACGTGAGTGTC CGGGCCAGCTTGCGCGCACCACGACTAATCCCACGGCCCACTGAACACCCTGCAAACTCAGTGGGCATCAGAAGACTTGTCTTGTGGAACCCATCAATTA GAAAAACTTTGGATCTTCCAGCTCCGAGTTCATGGGCTGCTATTGACAAGACTTTATTGGGCCTTGGCTATGATCCACAAAGTGACGACTATAAGGTTGC CAGGGTTGTGAGGCTAAAAAGCCCAGAATATGAGGACGAGCGTCCATTTGCTTTTCAATTTTACTCGCTCAATTCAGGATCTTGGAATGAAAACGCTGAT GTCAGCAGTAGTCTTGCGAATGAAGATACTTTGCGCAGCATCACCCTCCATGGCTTTGGCAATCCGGCCATTGTAAATGGGGTCATTCACTGGCTTCTAC ATCCTAGAGAAAATAACGGTATGCTGGCACTATCCTTTGATTTAAGCAATAATTCATTCGGAGAGTTAATGCTGCCTGAATGTTTCGATCCGACGGAACG GATAGCAGCGATGTCCATTTCAGTGTTCAAGAACTCTCTTTCTTTCAATGTCCTTAAGGATTATGGCGGAAATTATGTTTGTGAGGTATGGGTGATGAGC CAATATGGTACGAGGGAATCATGGGACAAACAATACCGGATTGAAATGCTCGATATAGCAAGGCCGGTGGTTTTTAGGAGTAATGGAGAGATATTAATGG CAGGATATGCAAATTCTCAGTTAGTTTCATGTGATCCTCAGACACAGGAAATTCATGATACGGGGCTGGAGGTGTTACTTGATGACTACGCTGATTATTT TGTTGAGAGTCTCGCTTTACTTGATAGATCAAACTAG
AA sequence Show only first row Show all	>Potri.003G145950.1 pacid=42787482 polypeptide=Potri.003G145950.1.p locus=Potri.003G145950 ID=Potri.003G145950.1.v4.1 annot-version=v4.1 MTGVAKDSITKDMVMQILLKLPVKSMLRFRCASKSWNSLVTSPGFMKNHLDKAKQLLLLRTENPVVSYSLHLDNDRVDMRSRLEFPIPNEAGLFLIYVSV RASLRAPRLIPRPTEHPANSVGIRRLVLWNPSIRKTLDLPAPSSWAAIDKTLLGLGYDPQSDDYKVARVVRLKSPEYEDERPFAFQFYSLNSGSWNENAD VSSSLANEDTLRSITLHGFGNPAIVNGVIHWLLHPRENNGMLALSFDLSNNSFGELMLPECFDPTERIAAMSISVFKNSLSFNVLKDYGGNYVCEVWVMS QYGTRESWDKQYRIEMLDIARPVVFRSNGEILMAGYANSQLVSCDPQTQEIHDTGLEVLLDDYADYFVESLALLDRSN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Potri.003G145950 [exp]	0	1
					Potri.009G092300 [exp]	8.42	0.9102	AGP9.1
AT5G03340			ATPase, AAA-type, CDC48 protei...		Potri.017G108200 [exp]	14.00	0.8510
AT5G13710		CPH, SMT1	CEPHALOPOD, sterol methyltrans...		Potri.001G263700 [exp]	18.00	0.8914
AT3G22070			proline-rich family protein (....		Potri.007G120101 [exp]	24.59	0.8811
AT1G30300			Metallo-hydrolase/oxidoreducta...		Potri.011G081600 [exp]	26.83	0.8875
AT5G59410			Rab5-interacting family protei...		Potri.001G241500 [exp]	27.34	0.8882
AT5G51840			unknown protein		Potri.012G132766 [exp]	28.49	0.8775
AT3G19460			Reticulon family protein (.1.2...		Potri.001G300400 [exp]	28.98	0.8848
AT5G60980			Nuclear transport factor 2 (NT...		Potri.015G058700 [exp]	31.12	0.8760
AT3G53020		RPL24B, STV1	SHORT VALVE1, Ribosomal protei...		Potri.015G141900 [exp]	32.17	0.8882

Compare expression of checked genes

Potri.003G145950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.