Plant FIBer expression Database

Potri.003G148100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G31335 37 / 5e-05 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G082332
[exp]
54 / 2e-11 AT1G31335 / unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036190
[exp]
52 / 1e-10 AT1G31335 67 / 1e-16 unknown protein
Lus10038328
[exp]
52 / 1e-10 AT1G31335 64 / 2e-15 unknown protein
PFAM info
Representative CDS sequence
>Potri.003G148100.1 pacid=42786611 polypeptide=Potri.003G148100.1.p locus=Potri.003G148100 ID=Potri.003G148100.1.v4.1 annot-version=v4.1
ATGGGTATGGTAGTGGTGATCTCTTTGCCTTTGATAATCTTCTGCTTACTTCTTGGTTTTGGATGCTACTACTTGGGGAGATACAAAGGAAGACAAGATG
TCCGTACAAATGCTCAAGTTTTTGGGGTACCTATTCCACCACCTGGTACTGCTAGTAAACCACCTCCTCCACCTCATTCCAAGCCAGGAAACTTGGAGAA
TGTTTAG
AA sequence
>Potri.003G148100.1 pacid=42786611 polypeptide=Potri.003G148100.1.p locus=Potri.003G148100 ID=Potri.003G148100.1.v4.1 annot-version=v4.1
MGMVVVISLPLIIFCLLLGFGCYYLGRYKGRQDVRTNAQVFGVPIPPPGTASKPPPPPHSKPGNLENV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G31335 unknown protein Potri.003G148100
[exp]
0 1
AT2G05790 O-Glycosyl hydrolases family 1... Potri.002G224600
[exp]
1.41 0.9670
AT3G20060 UBC19 ubiquitin-conjugating enzyme19... Potri.009G049600
[exp]
1.41 0.9682 Pt-UBC19.1
AT1G31335 unknown protein Potri.001G082332
[exp]
2.64 0.9560
AT1G04030 unknown protein Potri.002G258501
[exp]
6.92 0.9606
AT4G36360 BGAL3 beta-galactosidase 3 (.1.2) Potri.007G018100
[exp]
8.24 0.9223 Pt-BGAL3.1
AT4G20900 TDM1, MS5 MALE-STERILE 5, Tetratricopept... Potri.011G163500
[exp]
8.94 0.9516
AT4G35730 Regulator of Vps4 activity in ... Potri.007G059800
[exp]
9.79 0.9511
AT2G25060 AtENODL14 early nodulin-like protein 14 ... Potri.018G018200
[exp]
10.19 0.9541
AT5G16250 unknown protein Potri.008G078000
[exp]
10.72 0.9596
AT4G08330 unknown protein Potri.005G070600
[exp]
10.81 0.9518

Potri.003G148100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.