Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25140 125 / 2e-37 OLE1, OLEO1 oleosin 1 (.1) AT5G51210 119 / 2e-35 OLEO3 oleosin3 (.1) AT2G25890 102 / 2e-28 Oleosin family protein (.1) AT3G01570 88 / 9e-23 Oleosin family protein (.1) AT5G40420 73 / 1e-16 OLE2, PA23, OLEO2 oleosin 2 (.1) AT5G07550 70 / 1e-16 ATGRP19, GRP19 glycine-rich protein 19 (.1.2.3) AT5G61610 74 / 2e-16 Oleosin family protein (.1) AT3G27660 70 / 1e-15 OLE3, OLEO4 OLEOSIN 3, oleosin 4 (.1) AT5G07560 64 / 2e-13 ATGRP20, GRP20 glycine-rich protein 20 (.1) AT5G07540 62 / 3e-12 ATGRP16, ATGRP-6, GRP16 glycine-rich protein 16 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G080000 [exp] 184 / 5e-61 AT4G25140 108 / 1e-30 oleosin 1 (.1) Potri.006G234900 [exp] 116 / 3e-34 AT2G25890 113 / 1e-32 Oleosin family protein (.1) Potri.018G057800 [exp] 104 / 1e-29 AT2G25890 91 / 5e-24 Oleosin family protein (.1) Potri.012G083400 [exp] 82 / 1e-20 AT5G40420 97 / 2e-25 oleosin 2 (.1) Potri.T125308 [exp] 79 / 2e-19 AT5G40420 108 / 5e-30 oleosin 2 (.1) Potri.015G081901 [exp] 79 / 2e-19 AT5G40420 108 / 5e-30 oleosin 2 (.1) Potri.001G345800 [exp] 77 / 1e-18 AT3G01570 140 / 6e-43 Oleosin family protein (.1) Potri.017G071800 [exp] 76 / 2e-18 AT3G01570 130 / 4e-39 Oleosin family protein (.1) Potri.012G059400 [exp] 67 / 8e-15 AT3G18570 113 / 4e-32 Oleosin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031387 [exp] 151 / 6e-48 AT4G25140 164 / 1e-52 oleosin 1 (.1) Lus10027161 [exp] 147 / 2e-46 AT4G25140 154 / 3e-48 oleosin 1 (.1) Lus10039683 [exp] 147 / 5e-46 AT4G25140 159 / 2e-50 oleosin 1 (.1) Lus10017460 [exp] 142 / 2e-44 AT4G25140 136 / 9e-42 oleosin 1 (.1) Lus10028822 [exp] 141 / 4e-44 AT4G25140 146 / 3e-46 oleosin 1 (.1) Lus10010943 [exp] 149 / 5e-43 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1) Lus10022141 [exp] 96 / 1e-24 AT4G25140 106 / 3e-28 oleosin 1 (.1) Lus10017992 [exp] 70 / 2e-15 AT3G18570 136 / 4e-41 Oleosin family protein (.1) Lus10032461 [exp] 70 / 2e-15 AT3G18570 142 / 1e-43 Oleosin family protein (.1) Lus10042957 [exp] 68 / 6e-15 AT3G18570 139 / 2e-42 Oleosin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01277 [poplar] [flax] Oleosin Oleosin
Representative CDS sequence Show only first row Show all	>Potri.003G150600.1 pacid=42787425 polypeptide=Potri.003G150600.1.p locus=Potri.003G150600 ID=Potri.003G150600.1.v4.1 annot-version=v4.1 ATGGCTGATCTTCAAAAATCAAAGCACCCACGGCAACAACCAAGGTCCCACCAAGTAGTCAAGGCAACTACTGCTGTCACTACCGGTGGGTCTCTTTTAG TTGTCTCCAGTTTGACCTTTACTGCCACCGTCATTCTGTTGACCGTAGCCACTCCATTGCTGATCATATTCAGTCCAGTTATCGTTCCTGCTGTGATAAC AATTTATCTCTTGCTTATGGGGTTCTTAGCCTCTGGTGGCTTCGGCGTAACAGGAATTACTGTCATGTCATGGATGTACAGGTATGTTACTGGGAGGCAT CCTCCAGGGGCAGAACAGCTGGACCAGGCAGGCATGAAGCTGGTTGGTAAGGCAAGGGAAATGAAAGAACGGGGTGAGCAGTTTGGGCTACAAGCTGCCC AATAG
AA sequence Show only first row Show all	>Potri.003G150600.1 pacid=42787425 polypeptide=Potri.003G150600.1.p locus=Potri.003G150600 ID=Potri.003G150600.1.v4.1 annot-version=v4.1 MADLQKSKHPRQQPRSHQVVKATTAVTTGGSLLVVSSLTFTATVILLTVATPLLIIFSPVIVPAVITIYLLLMGFLASGGFGVTGITVMSWMYRYVTGRH PPGAEQLDQAGMKLVGKAREMKERGEQFGLQAAQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G25140		OLE1, OLEO1	oleosin 1 (.1)		Potri.003G150600 [exp]	0	1
AT1G70210		ATCYCD1;1, CYCD...	CYCLIN D1;1 (.1)		Potri.009G086700 [exp]	7.68	0.6586
					Potri.011G080201 [exp]	7.87	0.5610
AT5G20820			SAUR-like auxin-responsive pro...		Potri.006G137000 [exp]	13.11	0.6132	SAUR6
AT5G60800			Heavy metal transport/detoxifi...		Potri.004G214700 [exp]	20.34	0.6020
AT5G66590			CAP (Cysteine-rich secretory p...		Potri.007G033200 [exp]	27.23	0.6041
AT5G26730			Fasciclin-like arabinogalactan...		Potri.006G016700 [exp]	33.16	0.5301
					Potri.010G001200 [exp]	46.90	0.6029
AT3G13890	MYB	ATMYB26, MS35	MALE STERILE 35, myb domain pr...		Potri.001G197000 [exp]	51.38	0.5672
AT1G80530			Major facilitator superfamily ...		Potri.003G012300 [exp]	64.49	0.5650
AT5G64620		ATC/VIF2, C/VIF...	cell wall / vacuolar inhibitor...		Potri.016G001600 [exp]	67.50	0.5357

Compare expression of checked genes

Potri.003G150600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.