Potri.003G152701 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.003G152701.1 pacid=42787037 polypeptide=Potri.003G152701.1.p locus=Potri.003G152701 ID=Potri.003G152701.1.v4.1 annot-version=v4.1
ATGATAATCTTCATGTTATCTTTGGACATTTATATATGCTTCTATAGACATTTGTGCAGTTCGATTCTAAAACTGCAGAGCTTATGTACGTCATATTTAT
GGTTTAATGAAGAGATGTTCTGTGAGTTTCACTGTGCTCTATATATTTATCCATCTCCCAACAAGTCAGGAATTAAGTATGCATATTTTTTCATGCTTCA
TGAAGAGTTTGATAAAGGTGAAATCTTGTGGCAGGTTCTCTGA
AA sequence
>Potri.003G152701.1 pacid=42787037 polypeptide=Potri.003G152701.1.p locus=Potri.003G152701 ID=Potri.003G152701.1.v4.1 annot-version=v4.1
MIIFMLSLDIYICFYRHLCSSILKLQSLCTSYLWFNEEMFCEFHCALYIYPSPNKSGIKYAYFFMLHEEFDKGEILWQVL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.003G152701 0 1
Potri.011G072716 8.24 0.8680
AT3G18040 ATMPK9 MAP kinase 9 (.1.2) Potri.012G048600 8.48 0.8120
AT5G38770 ATGDU7 glutamine dumper 7 (.1) Potri.004G108440 8.71 0.9034
AT2G27510 ATFD3 ferredoxin 3 (.1) Potri.004G202500 9.16 0.8795
AT3G09390 ATMT-K, ATMT-1,... ARABIDOPSIS THALIANA METALLOTH... Potri.009G030800 13.07 0.8646
Potri.005G123600 13.19 0.8945
AT5G45920 SGNH hydrolase-type esterase s... Potri.011G063800 13.41 0.8469
AT3G56630 CYP94D2 "cytochrome P450, family 94, s... Potri.016G031850 13.60 0.8975
AT2G23620 ATMES1 ARABIDOPSIS THALIANA METHYL ES... Potri.005G133700 17.32 0.8339
AT2G23620 ATMES1 ARABIDOPSIS THALIANA METHYL ES... Potri.005G133600 17.54 0.8380

Potri.003G152701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.