Potri.003G155400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038397 50 / 2e-08 ND 38 / 3e-04
Lus10001224 49 / 2e-08 AT1G30880 38 / 3e-04 unknown protein
PFAM info
Representative CDS sequence
>Potri.003G155400.1 pacid=42785241 polypeptide=Potri.003G155400.1.p locus=Potri.003G155400 ID=Potri.003G155400.1.v4.1 annot-version=v4.1
ATGGCGAAATCTATGAGATCGAAGAGAGAGAAGAGGCTACGAGCAATAAGGAGAGATCTAGTACAGCCTCTTTGTGACAAGAAAGATGAAGCAAAGTTTG
CTGTTCTAGAAGCTGCCCTCGCAGCTCCCAAGCTTCCAGTTAAACCCTCTCCATTCGCTTCTTCTTCCTCTTCTTCTGCTATGGACACAACGACAATTAC
CACCACCACCACCACCACCACAGATACTCAAATTGATATGGAAATGGACGATGGCAATCAAACAAAGAGGTCATTGAAGCCGATAGGGAAGAAGCTAAAA
AAGAAATTGAAGCTGTCAAGAAAGAAGAACCATGGAAAGGGGAGGATCAGGAGGAAACATATTTAA
AA sequence
>Potri.003G155400.1 pacid=42785241 polypeptide=Potri.003G155400.1.p locus=Potri.003G155400 ID=Potri.003G155400.1.v4.1 annot-version=v4.1
MAKSMRSKREKRLRAIRRDLVQPLCDKKDEAKFAVLEAALAAPKLPVKPSPFASSSSSSAMDTTTITTTTTTTTDTQIDMEMDDGNQTKRSLKPIGKKLK
KKLKLSRKKNHGKGRIRRKHI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G30880 unknown protein Potri.003G155400 0 1
AT1G80750 Ribosomal protein L30/L7 famil... Potri.001G047400 1.41 0.8825
AT2G37990 ribosome biogenesis regulatory... Potri.005G231000 2.00 0.8359
AT1G02090 ATCSN7, COP15, ... FUSCA 5, CONSTITUTIVE PHOTOMOR... Potri.014G047200 3.16 0.7981
AT5G10010 unknown protein Potri.005G083700 3.87 0.7595
AT3G13882 Ribosomal protein L34 (.1.2) Potri.003G041100 5.47 0.7971
AT5G02820 BIN5, RHL2 ROOT HAIRLESS 2, BRASSINOSTERO... Potri.006G132600 7.74 0.8075 Pt-RHL2.1
AT1G80750 Ribosomal protein L30/L7 famil... Potri.003G180700 7.93 0.8302
AT5G15750 Alpha-L RNA-binding motif/Ribo... Potri.017G101200 9.38 0.7765
AT4G29510 ATPRMT1B, ATPRM... PROTEIN ARGININE METHYLTRANSFE... Potri.006G149400 9.94 0.7703
AT3G22660 rRNA processing protein-relate... Potri.015G131200 15.49 0.7496

Potri.003G155400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.