Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G44635 116 / 4e-32 MCM6 MINICHROMOSOME MAINTENANCE 6, minichromosome maintenance (MCM2/3/5) family protein (.1) AT2G16440 84 / 9e-21 MCM4 MINICHROMOSOME MAINTENANCE 4, Minichromosome maintenance (MCM2/3/5) family protein (.1) AT4G02060 73 / 6e-17 MCM7, PRL PROLIFERA, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2) AT1G44900 72 / 1e-16 ATMCM2, MCM2 MINICHROMOSOME MAINTENANCE 2, minichromosome maintenance (MCM2/3/5) family protein (.1), minichromosome maintenance (MCM2/3/5) family protein (.2) AT2G07690 72 / 2e-16 MCM5 MINICHROMOSOME MAINTENANCE 5, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2) AT3G09660 70 / 9e-16 MCM8 minichromosome maintenance 8 (.1) AT5G46280 69 / 2e-15 MCM3 MINICHROMOSOME MAINTENANCE 3, Minichromosome maintenance (MCM2/3/5) family protein (.1) AT2G14050 61 / 1e-12 MCM9 minichromosome maintenance 9 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G074000 [exp] 115 / 7e-32 AT5G44635 1312 / 0.0 MINICHROMOSOME MAINTENANCE 6, minichromosome maintenance (MCM2/3/5) family protein (.1) Potri.009G121500 [exp] 83 / 2e-20 AT2G16440 1236 / 0.0 MINICHROMOSOME MAINTENANCE 4, Minichromosome maintenance (MCM2/3/5) family protein (.1) Potri.014G121000 [exp] 78 / 1e-18 AT4G02060 1255 / 0.0 PROLIFERA, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2) Potri.001G070500 [exp] 73 / 7e-17 AT1G44900 1348 / 0.0 MINICHROMOSOME MAINTENANCE 2, minichromosome maintenance (MCM2/3/5) family protein (.1), minichromosome maintenance (MCM2/3/5) family protein (.2) Potri.018G112800 [exp] 72 / 1e-16 AT2G07690 1173 / 0.0 MINICHROMOSOME MAINTENANCE 5, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2) Potri.006G131900 [exp] 71 / 3e-16 AT3G09660 1037 / 0.0 minichromosome maintenance 8 (.1) Potri.006G188700 [exp] 71 / 3e-16 AT2G07690 1170 / 0.0 MINICHROMOSOME MAINTENANCE 5, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2) Potri.004G131600 [exp] 68 / 5e-15 AT5G46280 1123 / 0.0 MINICHROMOSOME MAINTENANCE 3, Minichromosome maintenance (MCM2/3/5) family protein (.1) Potri.019G014403 [exp] 63 / 3e-13 AT2G14050 989 / 0.0 minichromosome maintenance 9 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038384 [exp] 114 / 2e-31 AT5G44635 1257 / 0.0 MINICHROMOSOME MAINTENANCE 6, minichromosome maintenance (MCM2/3/5) family protein (.1) Lus10036244 [exp] 114 / 2e-31 AT5G44635 1262 / 0.0 MINICHROMOSOME MAINTENANCE 6, minichromosome maintenance (MCM2/3/5) family protein (.1) Lus10028795 [exp] 80 / 3e-19 AT2G16440 1255 / 0.0 MINICHROMOSOME MAINTENANCE 4, Minichromosome maintenance (MCM2/3/5) family protein (.1) Lus10017491 [exp] 80 / 4e-19 AT2G16440 1225 / 0.0 MINICHROMOSOME MAINTENANCE 4, Minichromosome maintenance (MCM2/3/5) family protein (.1) Lus10001452 [exp] 77 / 2e-18 AT4G02060 1224 / 0.0 PROLIFERA, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2) Lus10002427 [exp] 77 / 2e-18 AT4G02060 1223 / 0.0 PROLIFERA, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2) Lus10009052 [exp] 74 / 4e-17 AT1G44900 1263 / 0.0 MINICHROMOSOME MAINTENANCE 2, minichromosome maintenance (MCM2/3/5) family protein (.1), minichromosome maintenance (MCM2/3/5) family protein (.2) Lus10009683 [exp] 73 / 1e-16 AT1G44900 963 / 0.0 MINICHROMOSOME MAINTENANCE 2, minichromosome maintenance (MCM2/3/5) family protein (.1), minichromosome maintenance (MCM2/3/5) family protein (.2) Lus10019592 [exp] 70 / 1e-15 AT2G07690 1075 / 0.0 MINICHROMOSOME MAINTENANCE 5, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2) Lus10040017 [exp] 70 / 1e-15 AT2G07690 1060 / 0.0 MINICHROMOSOME MAINTENANCE 5, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00493 [poplar] [flax] MCM MCM P-loop domain
Representative CDS sequence Show only first row Show all	>Potri.003G157001.1 pacid=42785274 polypeptide=Potri.003G157001.1.p locus=Potri.003G157001 ID=Potri.003G157001.1.v4.1 annot-version=v4.1 ATGCTTGTATTGTTGGTGATCCCAGCTGTGCAAAATCTCAGTCCCTCAAGTATAGTTCCCAGATCCGTCTACACACCTGGAAAATCATCATCTGCTGCTG GGTTGACAGCAACTGTGGCTAAAGAACCAGAAACTGGGGAATTTTGTATTGAGGCTGGTGCATTGATGCTTGCTGACAGTGGCATTTGTTGCATTGATGA GTTTGACAAGATGGATATTTGA
AA sequence Show only first row Show all	>Potri.003G157001.1 pacid=42785274 polypeptide=Potri.003G157001.1.p locus=Potri.003G157001 ID=Potri.003G157001.1.v4.1 annot-version=v4.1 MLVLLVIPAVQNLSPSSIVPRSVYTPGKSSSAAGLTATVAKEPETGEFCIEAGALMLADSGICCIDEFDKMDI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G44635		MCM6	MINICHROMOSOME MAINTENANCE 6, ...		Potri.003G157001 [exp]	0	1
AT4G00910			Aluminium activated malate tra...		Potri.001G085900 [exp]	9.05	0.9184
AT1G66370	MYB	ATMYB113	myb domain protein 113 (.1)		Potri.017G125700 [exp]	12.80	0.9104
AT2G14610		PR-1, PR1, ATPR...	pathogenesis-related gene 1 (....		Potri.009G082800 [exp]	13.96	0.9099
AT4G19690		ATIRT1, IRT1	ARABIDOPSIS IRON-REGULATED TRA...		Potri.015G117900 [exp]	17.77	0.9095	Pt-ZIP6.4
AT3G53480		PIS1, ABCG37, P...	polar auxin transport inhibito...		Potri.015G006000 [exp]	21.44	0.9094
AT1G80830		ATNRAMP1, PMIT1...	natural resistance-associated ...		Potri.005G181100 [exp]	22.04	0.9075	Pt-NRAMP1.4
AT1G80830		ATNRAMP1, PMIT1...	natural resistance-associated ...		Potri.005G181000 [exp]	24.53	0.9066
AT1G65570			Pectin lyase-like superfamily ...		Potri.010G177501 [exp]	26.83	0.9048
AT3G12900			2-oxoglutarate (2OG) and Fe(II...		Potri.005G097900 [exp]	27.16	0.9056
AT3G13610			2-oxoglutarate (2OG) and Fe(II...		Potri.001G006800 [exp]	31.55	0.9003

Compare expression of checked genes

Potri.003G157001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.