Potri.003G157001 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G44635 116 / 4e-32 MCM6 MINICHROMOSOME MAINTENANCE 6, minichromosome maintenance (MCM2/3/5) family protein (.1)
AT2G16440 84 / 9e-21 MCM4 MINICHROMOSOME MAINTENANCE 4, Minichromosome maintenance (MCM2/3/5) family protein (.1)
AT4G02060 73 / 6e-17 MCM7, PRL PROLIFERA, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2)
AT1G44900 72 / 1e-16 ATMCM2, MCM2 MINICHROMOSOME MAINTENANCE 2, minichromosome maintenance (MCM2/3/5) family protein (.1), minichromosome maintenance (MCM2/3/5) family protein (.2)
AT2G07690 72 / 2e-16 MCM5 MINICHROMOSOME MAINTENANCE 5, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2)
AT3G09660 70 / 9e-16 MCM8 minichromosome maintenance 8 (.1)
AT5G46280 69 / 2e-15 MCM3 MINICHROMOSOME MAINTENANCE 3, Minichromosome maintenance (MCM2/3/5) family protein (.1)
AT2G14050 61 / 1e-12 MCM9 minichromosome maintenance 9 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G074000 115 / 7e-32 AT5G44635 1312 / 0.0 MINICHROMOSOME MAINTENANCE 6, minichromosome maintenance (MCM2/3/5) family protein (.1)
Potri.009G121500 83 / 2e-20 AT2G16440 1236 / 0.0 MINICHROMOSOME MAINTENANCE 4, Minichromosome maintenance (MCM2/3/5) family protein (.1)
Potri.014G121000 78 / 1e-18 AT4G02060 1255 / 0.0 PROLIFERA, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2)
Potri.001G070500 73 / 7e-17 AT1G44900 1348 / 0.0 MINICHROMOSOME MAINTENANCE 2, minichromosome maintenance (MCM2/3/5) family protein (.1), minichromosome maintenance (MCM2/3/5) family protein (.2)
Potri.018G112800 72 / 1e-16 AT2G07690 1173 / 0.0 MINICHROMOSOME MAINTENANCE 5, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2)
Potri.006G131900 71 / 3e-16 AT3G09660 1037 / 0.0 minichromosome maintenance 8 (.1)
Potri.006G188700 71 / 3e-16 AT2G07690 1170 / 0.0 MINICHROMOSOME MAINTENANCE 5, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2)
Potri.004G131600 68 / 5e-15 AT5G46280 1123 / 0.0 MINICHROMOSOME MAINTENANCE 3, Minichromosome maintenance (MCM2/3/5) family protein (.1)
Potri.019G014403 63 / 3e-13 AT2G14050 989 / 0.0 minichromosome maintenance 9 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038384 114 / 2e-31 AT5G44635 1257 / 0.0 MINICHROMOSOME MAINTENANCE 6, minichromosome maintenance (MCM2/3/5) family protein (.1)
Lus10036244 114 / 2e-31 AT5G44635 1262 / 0.0 MINICHROMOSOME MAINTENANCE 6, minichromosome maintenance (MCM2/3/5) family protein (.1)
Lus10028795 80 / 3e-19 AT2G16440 1255 / 0.0 MINICHROMOSOME MAINTENANCE 4, Minichromosome maintenance (MCM2/3/5) family protein (.1)
Lus10017491 80 / 4e-19 AT2G16440 1225 / 0.0 MINICHROMOSOME MAINTENANCE 4, Minichromosome maintenance (MCM2/3/5) family protein (.1)
Lus10001452 77 / 2e-18 AT4G02060 1224 / 0.0 PROLIFERA, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2)
Lus10002427 77 / 2e-18 AT4G02060 1223 / 0.0 PROLIFERA, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2)
Lus10009052 74 / 4e-17 AT1G44900 1263 / 0.0 MINICHROMOSOME MAINTENANCE 2, minichromosome maintenance (MCM2/3/5) family protein (.1), minichromosome maintenance (MCM2/3/5) family protein (.2)
Lus10009683 73 / 1e-16 AT1G44900 963 / 0.0 MINICHROMOSOME MAINTENANCE 2, minichromosome maintenance (MCM2/3/5) family protein (.1), minichromosome maintenance (MCM2/3/5) family protein (.2)
Lus10019592 70 / 1e-15 AT2G07690 1075 / 0.0 MINICHROMOSOME MAINTENANCE 5, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2)
Lus10040017 70 / 1e-15 AT2G07690 1060 / 0.0 MINICHROMOSOME MAINTENANCE 5, Minichromosome maintenance (MCM2/3/5) family protein (.1), Minichromosome maintenance (MCM2/3/5) family protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00493 MCM MCM P-loop domain
Representative CDS sequence
>Potri.003G157001.1 pacid=42785274 polypeptide=Potri.003G157001.1.p locus=Potri.003G157001 ID=Potri.003G157001.1.v4.1 annot-version=v4.1
ATGCTTGTATTGTTGGTGATCCCAGCTGTGCAAAATCTCAGTCCCTCAAGTATAGTTCCCAGATCCGTCTACACACCTGGAAAATCATCATCTGCTGCTG
GGTTGACAGCAACTGTGGCTAAAGAACCAGAAACTGGGGAATTTTGTATTGAGGCTGGTGCATTGATGCTTGCTGACAGTGGCATTTGTTGCATTGATGA
GTTTGACAAGATGGATATTTGA
AA sequence
>Potri.003G157001.1 pacid=42785274 polypeptide=Potri.003G157001.1.p locus=Potri.003G157001 ID=Potri.003G157001.1.v4.1 annot-version=v4.1
MLVLLVIPAVQNLSPSSIVPRSVYTPGKSSSAAGLTATVAKEPETGEFCIEAGALMLADSGICCIDEFDKMDI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G44635 MCM6 MINICHROMOSOME MAINTENANCE 6, ... Potri.003G157001 0 1
AT4G00910 Aluminium activated malate tra... Potri.001G085900 9.05 0.9184
AT1G66370 MYB ATMYB113 myb domain protein 113 (.1) Potri.017G125700 12.80 0.9104
AT2G14610 PR-1, PR1, ATPR... pathogenesis-related gene 1 (.... Potri.009G082800 13.96 0.9099
AT4G19690 ATIRT1, IRT1 ARABIDOPSIS IRON-REGULATED TRA... Potri.015G117900 17.77 0.9095 Pt-ZIP6.4
AT3G53480 PIS1, ABCG37, P... polar auxin transport inhibito... Potri.015G006000 21.44 0.9094
AT1G80830 ATNRAMP1, PMIT1... natural resistance-associated ... Potri.005G181100 22.04 0.9075 Pt-NRAMP1.4
AT1G80830 ATNRAMP1, PMIT1... natural resistance-associated ... Potri.005G181000 24.53 0.9066
AT1G65570 Pectin lyase-like superfamily ... Potri.010G177501 26.83 0.9048
AT3G12900 2-oxoglutarate (2OG) and Fe(II... Potri.005G097900 27.16 0.9056
AT3G13610 2-oxoglutarate (2OG) and Fe(II... Potri.001G006800 31.55 0.9003

Potri.003G157001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.