RPL21.1 (Potri.003G159500) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol RPL21.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G09690 305 / 3e-108 Translation protein SH3-like family protein (.1)
AT1G09590 305 / 3e-108 Translation protein SH3-like family protein (.1)
AT1G57860 304 / 8e-108 Translation protein SH3-like family protein (.1)
AT1G57660 304 / 8e-108 Translation protein SH3-like family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G071100 325 / 3e-116 AT1G09690 307 / 7e-109 Translation protein SH3-like family protein (.1)
Potri.006G195400 313 / 2e-111 AT1G57860 305 / 5e-108 Translation protein SH3-like family protein (.1)
Potri.016G061100 310 / 4e-110 AT1G57860 305 / 7e-108 Translation protein SH3-like family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016241 299 / 1e-105 AT1G09590 295 / 4e-104 Translation protein SH3-like family protein (.1)
Lus10029302 296 / 1e-104 AT1G09690 294 / 1e-103 Translation protein SH3-like family protein (.1)
Lus10030607 296 / 2e-104 AT1G09590 295 / 4e-104 Translation protein SH3-like family protein (.1)
Lus10030882 296 / 3e-104 AT1G09690 296 / 2e-104 Translation protein SH3-like family protein (.1)
Lus10021079 284 / 9e-100 AT1G09590 292 / 6e-103 Translation protein SH3-like family protein (.1)
Lus10017232 284 / 9e-100 AT1G09590 292 / 6e-103 Translation protein SH3-like family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF01157 Ribosomal_L21e Ribosomal protein L21e
Representative CDS sequence
>Potri.003G159500.1 pacid=42785654 polypeptide=Potri.003G159500.1.p locus=Potri.003G159500 ID=Potri.003G159500.1.v4.1 annot-version=v4.1
ATGCCAGCTGGACATGGTTTGCGATCAAGGACCAGAGATCTCTTCGCTCGTCCCTTCAGGAAGAAGGGTTACATCCCTCTCACCACATACCTCAGAACGT
ACAAGGTAGGCGACTATGTCGACATTAAGGTAAATGGCGCTGTCCACAAAGGCATGCCCCACAAGTTCTACCATGGCCGCACCGGTCGCGTCTGGAATGT
AACCAAGCGCGCTATTGGTGTCGTCATCAACAAGCAGGTTGGGAATAGGATTATTGGGAAGAGAATTCATGTTAGGGTGGAGCATGTGCAGCCGTCGAGG
TGCAGGGAGGAGTTCAAGTTGAGGAAGAAGAAGAATGATGAGTTGAAGGCGGAGGCCAAAGCTCGTGGTGAAAAGATTAGTACTAAGAGACAGCCTCAAG
GACCGAAGCCCGGATTTATGGTGGAGGGTGCTACTCTTGAGACTTTCACTCCCATTCCTTATGATGTGGTCAATGATCTCAAGGGTGGTTATTGA
AA sequence
>Potri.003G159500.1 pacid=42785654 polypeptide=Potri.003G159500.1.p locus=Potri.003G159500 ID=Potri.003G159500.1.v4.1 annot-version=v4.1
MPAGHGLRSRTRDLFARPFRKKGYIPLTTYLRTYKVGDYVDIKVNGAVHKGMPHKFYHGRTGRVWNVTKRAIGVVINKQVGNRIIGKRIHVRVEHVQPSR
CREEFKLRKKKNDELKAEAKARGEKISTKRQPQGPKPGFMVEGATLETFTPIPYDVVNDLKGGY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G09690 Translation protein SH3-like f... Potri.003G159500 0 1 RPL21.1
AT3G56340 Ribosomal protein S26e family ... Potri.019G057000 2.44 0.9689 RPS26.2
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Potri.002G140400 3.74 0.9621 Pt-RPS11.5
AT2G27710 60S acidic ribosomal protein f... Potri.009G146200 4.00 0.9685
AT5G62300 Ribosomal protein S10p/S20e fa... Potri.012G128300 5.47 0.9627 Pt-RPS20.1
AT4G25740 RNA binding Plectin/S10 domain... Potri.004G073500 6.00 0.9631
AT2G19730 Ribosomal L28e protein family ... Potri.003G045500 6.70 0.9629
AT3G02560 Ribosomal protein S7e family p... Potri.004G099200 9.59 0.9631
AT5G59850 Ribosomal protein S8 family pr... Potri.003G114800 10.00 0.9616 RPS15.1
AT5G02960 Ribosomal protein S12/S23 fami... Potri.006G131500 10.95 0.9619
AT1G26880 Ribosomal protein L34e superfa... Potri.015G106466 11.53 0.9475

Potri.003G159500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.