Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61110 145 / 3e-47 ARS27A ribosomal protein S27 (.1) AT2G45710 141 / 9e-46 Zinc-binding ribosomal protein family protein (.1) AT5G47930 139 / 8e-45 Zinc-binding ribosomal protein family protein (.1) AT3G61111 123 / 2e-38 Zinc-binding ribosomal protein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G069100 [exp] 151 / 1e-49 AT3G61110 145 / 4e-47 ribosomal protein S27 (.1) Potri.006G192900 [exp] 151 / 1e-49 AT3G61110 145 / 4e-47 ribosomal protein S27 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035122 [exp] 145 / 2e-47 AT3G61110 176 / 2e-59 ribosomal protein S27 (.1) Lus10031974 [exp] 145 / 2e-47 AT3G61110 176 / 2e-59 ribosomal protein S27 (.1) Lus10032212 [exp] 145 / 3e-47 AT3G61110 173 / 2e-58 ribosomal protein S27 (.1) Lus10031979 [exp] 145 / 3e-47 AT3G61110 173 / 2e-58 ribosomal protein S27 (.1) Lus10024576 [exp] 146 / 6e-47 AT3G61110 174 / 1e-57 ribosomal protein S27 (.1) Lus10035128 [exp] 0 / 1 AT3G61110 84 / 1e-32 ribosomal protein S27 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [poplar] [flax] Zn_Beta_Ribbon PF01667 [poplar] [flax] Ribosomal_S27e Ribosomal protein S27
Representative CDS sequence Show only first row Show all	>Potri.003G161200.1 pacid=42786025 polypeptide=Potri.003G161200.1.p locus=Potri.003G161200 ID=Potri.003G161200.1.v4.1 annot-version=v4.1 ATGGTTCTCCAAAACGATATCGATTTGCTTAACCCACCAGCAGAGCTTGAGAAGAGGAAGCACAAGCTCAAGCGTCTTGTTCAGTCCCCCAATTCCTTTT TCATGGATGTGAAGTGCCAGGGTTGCTTCAACATAACAACAGTGTTTAGCCACTCCCAAACAGTTGTGGTGTGTGGGAACTGCCAGACAGTGTTGTGCCA ACCAACTGGGGGTCGTGCCAAGCTTACAGAGGGATGCTCGTTCAGGAAGAAGAGCGAGTGA
AA sequence Show only first row Show all	>Potri.003G161200.1 pacid=42786025 polypeptide=Potri.003G161200.1.p locus=Potri.003G161200 ID=Potri.003G161200.1.v4.1 annot-version=v4.1 MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHSQTVVVCGNCQTVLCQPTGGRAKLTEGCSFRKKSE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G61110		ARS27A	ribosomal protein S27 (.1)		Potri.003G161200 [exp]	0	1
AT4G25740			RNA binding Plectin/S10 domain...		Potri.005G040100 [exp]	3.46	0.9479
AT2G37600			Ribosomal protein L36e family ...		Potri.004G057000 [exp]	8.77	0.9243	RPL36.1
AT2G37190			Ribosomal protein L11 family p...		Potri.006G077200 [exp]	10.19	0.9329	RPL12.4
AT5G39850			Ribosomal protein S4 (.1)		Potri.007G056100 [exp]	11.66	0.9228
AT4G37660			Ribosomal protein L12/ ATP-dep...		Potri.004G224300 [exp]	13.67	0.8483
AT1G70600			Ribosomal protein L18e/L15 sup...		Potri.016G069000 [exp]	16.27	0.9253
AT1G74050			Ribosomal protein L6 family pr...		Potri.009G065800 [exp]	17.77	0.9276
AT4G14320			Zinc-binding ribosomal protein...		Potri.007G071800 [exp]	17.83	0.9244
AT3G02560			Ribosomal protein S7e family p...		Potri.004G099200 [exp]	17.91	0.9280
AT1G74050			Ribosomal protein L6 family pr...		Potri.001G271500 [exp]	20.24	0.9217

Compare expression of checked genes

Potri.003G161200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.