Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G13270 172 / 1e-49 RARE1 REQUIRED FOR ACCD RNA EDITING 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G59720 132 / 3e-35 CRR28 CHLORORESPIRATORY REDUCTION28, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G27610 130 / 1e-34 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G49710 129 / 3e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G13650 127 / 2e-33 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G22070 126 / 3e-33 pentatricopeptide (PPR) repeat-containing protein (.1) AT3G23330 124 / 1e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G49170 124 / 2e-32 EMB2261 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G12770 122 / 5e-32 MEF22 mitochondrial editing factor 22 (.1) AT4G37380 122 / 6e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G066100 [exp] 238 / 9e-74 AT5G13270 977 / 0.0 REQUIRED FOR ACCD RNA EDITING 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.015G018700 [exp] 135 / 2e-36 AT3G49170 1040 / 0.0 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G067500 [exp] 131 / 8e-35 AT4G13650 590 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G184800 [exp] 130 / 2e-34 AT2G27610 1061 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.016G128900 [exp] 129 / 2e-34 AT3G08820 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G155100 [exp] 129 / 5e-34 AT3G61170 933 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G354400 [exp] 128 / 7e-34 AT5G46460 863 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G105700 [exp] 127 / 2e-33 AT3G08820 810 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.002G027800 [exp] 127 / 2e-33 AT1G25360 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000110 [exp] 128 / 9e-36 AT4G37380 413 / 9e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10024971 [exp] 133 / 1e-35 AT4G37380 772 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10010998 [exp] 133 / 2e-35 AT4G16835 778 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10010385 [exp] 128 / 6e-34 AT4G37380 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10020588 [exp] 120 / 5e-33 AT2G27610 422 / 2e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10029436 [exp] 125 / 8e-33 AT3G08820 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10004892 [exp] 124 / 2e-32 AT2G27610 998 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10017446 [exp] 124 / 2e-32 AT1G11290 1152 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10018978 [exp] 124 / 3e-32 AT4G13650 1258 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10028837 [exp] 121 / 4e-32 AT1G11290 650 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat CL0109 [poplar] [flax] CDA PF14432 [poplar] [flax] DYW_deaminase DYW family of nucleic acid deaminases
Representative CDS sequence Show only first row Show all	>Potri.003G163701.1 pacid=42785144 polypeptide=Potri.003G163701.1.p locus=Potri.003G163701 ID=Potri.003G163701.1.v4.1 annot-version=v4.1 ATGTCTCTAAAATCAATTCCTCCTTCACTTAAAACCCATGAAAATAATAACAAAGCCCAAATTGAGAGTGTCCATTTGATTTCTCTATCTAAAGAGGGAA AGATCAAGGAAGCTCGTGAATTTCTCAAACAAATGGAGGAGGCTGGTAATTCTGTCAGCCCTCGTTCTTATCGATGCTTGTTGGAAGCGTGTGGAAAGTT TAAATCTTTATTGGATGGGAGATTGATTCATGAAGTAATACAAAGAACAGTGAAAGTCCCATTTGGGTTAGCCGAGAATCCAGCGCTGTCAATGTTATAT ATTCTTGTGTTTAACCTGTATGCTTCATTTAGGAAATGGAAAGAAGCAGCTGGTGTTAGGAAGATGATGACACAAAGAAGTTTGAGGAAGGAGGTTAGCT GCAGCTGGATTACTGTCAAGGGTAAAGTGCACCAGTTTATAAGTTTGCCTGGGAGGAAAGAACAGCCTCTAGTCCATAGTGAGAGATTTGCAATAGCATT TGGTCTCATATCTACACCAAGTAATGCTCCTGTTGTTCTTTTCAAGAACCTCAGGGCTTGCAAGGACCGCCATGATTTTGGTAAACAAGTGTCGTTGATC ACAGGACGTGAAATCATCGTTAGAGATTCTTTCAGTTTCCATCACTTCAAGTTAGGGGACTGTTCTTGCAATGACTACTGGTGA
AA sequence Show only first row Show all	>Potri.003G163701.1 pacid=42785144 polypeptide=Potri.003G163701.1.p locus=Potri.003G163701 ID=Potri.003G163701.1.v4.1 annot-version=v4.1 MSLKSIPPSLKTHENNNKAQIESVHLISLSKEGKIKEAREFLKQMEEAGNSVSPRSYRCLLEACGKFKSLLDGRLIHEVIQRTVKVPFGLAENPALSMLY ILVFNLYASFRKWKEAAGVRKMMTQRSLRKEVSCSWITVKGKVHQFISLPGRKEQPLVHSERFAIAFGLISTPSNAPVVLFKNLRACKDRHDFGKQVSLI TGREIIVRDSFSFHHFKLGDCSCNDYW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G13270		RARE1	REQUIRED FOR ACCD RNA EDITING ...		Potri.003G163701 [exp]	0	1
AT1G43760			DNAse I-like superfamily prote...		Potri.002G000402 [exp]	1.73	0.9084
AT4G18520			Pentatricopeptide repeat (PPR)...		Potri.002G091101 [exp]	4.89	0.9098
AT2G22070			pentatricopeptide (PPR) repeat...		Potri.007G085500 [exp]	10.67	0.9051
AT3G50420			Pentatricopeptide repeat (PPR)...		Potri.005G131800 [exp]	10.90	0.9041
AT1G16480			Tetratricopeptide repeat (TPR)...		Potri.007G068600 [exp]	14.42	0.9083
AT3G25060			Tetratricopeptide repeat (TPR)...		Potri.002G245200 [exp]	15.09	0.8968
AT2G15530			RING/U-box superfamily protein...		Potri.011G103301 [exp]	15.09	0.8864
AT1G23450			Tetratricopeptide repeat (TPR)...		Potri.008G212000 [exp]	17.32	0.8973
AT5G46100			Pentatricopeptide repeat (PPR)...		Potri.011G057900 [exp]	18.54	0.9026
AT1G13410			Tetratricopeptide repeat (TPR)...		Potri.008G121400 [exp]	18.89	0.8897

Compare expression of checked genes

Potri.003G163701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.