Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G03080 108 / 3e-26 kinase interacting (KIP1-like) family protein (.1) AT2G22560 107 / 1e-25 Kinase interacting (KIP1-like) family protein (.1) AT1G09720 104 / 5e-25 Kinase interacting (KIP1-like) family protein (.1) AT5G10500 103 / 1e-24 Kinase interacting (KIP1-like) family protein (.1) AT3G22790 103 / 2e-24 Kinase interacting (KIP1-like) family protein (.1) AT1G03470 99 / 4e-24 Kinase interacting (KIP1-like) family protein (.1), Kinase interacting (KIP1-like) family protein (.2) AT4G02710 101 / 9e-24 Kinase interacting (KIP1-like) family protein (.1) AT4G14760 100 / 2e-23 kinase interacting (KIP1-like) family protein (.1) AT2G47920 95 / 4e-23 Kinase interacting (KIP1-like) family protein (.1) AT2G30500 99 / 5e-23 Kinase interacting (KIP1-like) family protein (.1), Kinase interacting (KIP1-like) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G147300 [exp] 108 / 2e-26 AT2G22560 421 / 2e-131 Kinase interacting (KIP1-like) family protein (.1) Potri.002G207700 [exp] 107 / 3e-26 AT2G47920 136 / 2e-37 Kinase interacting (KIP1-like) family protein (.1) Potri.007G011300 [exp] 107 / 9e-26 AT2G22560 851 / 0.0 Kinase interacting (KIP1-like) family protein (.1) Potri.008G156250 [exp] 105 / 2e-25 AT3G22790 519 / 7e-168 Kinase interacting (KIP1-like) family protein (.1) Potri.002G049600 [exp] 105 / 4e-25 AT1G03080 1229 / 0.0 kinase interacting (KIP1-like) family protein (.1) Potri.010G083300 [exp] 105 / 5e-25 AT3G22790 1306 / 0.0 Kinase interacting (KIP1-like) family protein (.1) Potri.013G158100 [exp] 101 / 5e-24 AT2G30500 384 / 7e-127 Kinase interacting (KIP1-like) family protein (.1), Kinase interacting (KIP1-like) family protein (.2) Potri.014G135000 [exp] 100 / 6e-24 AT2G47920 129 / 4e-35 Kinase interacting (KIP1-like) family protein (.1) Potri.002G106400 [exp] 100 / 3e-23 AT1G58210 702 / 0.0 EMBRYO DEFECTIVE 1674, kinase interacting family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025717 [exp] 107 / 6e-26 AT2G22560 497 / 6e-158 Kinase interacting (KIP1-like) family protein (.1) Lus10035944 [exp] 105 / 3e-25 AT5G10500 280 / 3e-78 Kinase interacting (KIP1-like) family protein (.1) Lus10006896 [exp] 102 / 3e-24 AT1G03080 927 / 0.0 kinase interacting (KIP1-like) family protein (.1) Lus10014687 [exp] 102 / 4e-24 AT1G03080 938 / 0.0 kinase interacting (KIP1-like) family protein (.1) Lus10041192 [exp] 102 / 6e-24 AT4G14760 744 / 0.0 kinase interacting (KIP1-like) family protein (.1) Lus10002655 [exp] 101 / 7e-24 AT2G22560 511 / 9e-164 Kinase interacting (KIP1-like) family protein (.1) Lus10039359 [exp] 101 / 1e-23 AT3G22790 1402 / 0.0 Kinase interacting (KIP1-like) family protein (.1) Lus10042627 [exp] 100 / 2e-23 AT4G02710 624 / 0.0 Kinase interacting (KIP1-like) family protein (.1) Lus10040904 [exp] 98 / 4e-23 AT1G03470 110 / 5e-28 Kinase interacting (KIP1-like) family protein (.1), Kinase interacting (KIP1-like) family protein (.2) Lus10005933 [exp] 96 / 2e-22 AT1G03470 110 / 7e-28 Kinase interacting (KIP1-like) family protein (.1), Kinase interacting (KIP1-like) family protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07765 [poplar] [flax] KIP1 KIP1-like protein
Representative CDS sequence Show only first row Show all	>Potri.003G164200.1 pacid=42784654 polypeptide=Potri.003G164200.1.p locus=Potri.003G164200 ID=Potri.003G164200.1.v4.1 annot-version=v4.1 ATGGAGGAGCAGGACAAAGATGACAATTCTGCTTCTTTTTCATGGTGGTCTGATAGCCATAAGCGTCCTCAACAATCCCAATGGCTTCAAGCTACCCTCT CAGATTTGGATAACAAGACTAAAACGATCCTAAATATTATACAAGACGATGGGGATTCATTTGCAAAGAGAGCTGAGATGTTTTATCAGAGAAGACCGGA GCTTATAAACCTGGTGCACGACTTGCACAAATCCTACCGTTCTTTAGCAGAAAAGTACGATCAAATTAGATCTGAATGCGTTTATGTTTCCCATTTGAGA TCAATATCATCCTCTTCGTCATTAAACTCCTCCAAACAAGTTCAACTCTTCCAGGCACGCAACGAAGAAAATGCTGGAAGCACCAAATCGGAAGCACCAA CTTCCCTTCCTGACTCGGTTGCAGAAGAAAAATATAGCATTAGACGGGAAAATGAGTCCATGTCAAGTGAACAATACAAGATCCTGAAGACCGATCGTGA TGATGACAGGAACGTTAATGGAAGTGGGCTGGAAAAGATCATTAATGGTATTGGATTGAATGGAAACATTGATGGCGGTGATTTCCAAATGAAGAGCCTC GAAAAGGAGAAACTGCGGAATGAATTAAGGCTACAGGTCTCAGAACTTATAGATGATAGTTTGCAGCAGCAGAGTGAGCTAATAAAGAGAAATGACGAGA AGAGAGAAGTGATCAAGCATCTTCGTGCCCAAATCAGCAGGCTAATGGAAGAGAACAGGGTCCTGAAGAGTTATCTACCAAGCTACAAGGCGGATATGAA GCGGAACACCAAATCTCATGTATCAAAGCTGAAGGGGCTAAATTGCATTGGCAATTTTAAGGGCTAA
AA sequence Show only first row Show all	>Potri.003G164200.1 pacid=42784654 polypeptide=Potri.003G164200.1.p locus=Potri.003G164200 ID=Potri.003G164200.1.v4.1 annot-version=v4.1 MEEQDKDDNSASFSWWSDSHKRPQQSQWLQATLSDLDNKTKTILNIIQDDGDSFAKRAEMFYQRRPELINLVHDLHKSYRSLAEKYDQIRSECVYVSHLR SISSSSSLNSSKQVQLFQARNEENAGSTKSEAPTSLPDSVAEEKYSIRRENESMSSEQYKILKTDRDDDRNVNGSGLEKIINGIGLNGNIDGGDFQMKSL EKEKLRNELRLQVSELIDDSLQQQSELIKRNDEKREVIKHLRAQISRLMEENRVLKSYLPSYKADMKRNTKSHVSKLKGLNCIGNFKG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G03080			kinase interacting (KIP1-like)...		Potri.003G164200 [exp]	0	1
AT1G17745		PGDH	D-3-phosphoglycerate dehydroge...		Potri.010G249600 [exp]	2.64	0.9214
					Potri.006G056101 [exp]	3.74	0.9393
AT5G11890		EMB3135	EMBRYO DEFECTIVE 3135, unknown...		Potri.018G052500 [exp]	5.74	0.9289
AT2G38500			2-oxoglutarate (2OG) and Fe(II...		Potri.016G134500 [exp]	6.32	0.9266
AT4G28500	NAC	ANAC073, SND2, ...	SECONDARY WALL-ASSOCIATED NAC ...		Potri.007G135300 [exp]	9.74	0.9257
AT3G18660		PGSIP1, GUX1	glucuronic acid substitution o...		Potri.005G061600 [exp]	10.95	0.9240
AT5G35200			ENTH/ANTH/VHS superfamily prot...		Potri.018G125284 [exp]	11.22	0.9200
AT1G11860			Glycine cleavage T-protein fam...		Potri.004G009600 [exp]	11.22	0.9037	GDCST.2
AT2G32850			Protein kinase superfamily pro...		Potri.001G228100 [exp]	13.67	0.9080
AT5G66310			ATP binding microtubule motor ...		Potri.007G014800 [exp]	15.29	0.9136

Compare expression of checked genes

Potri.003G164200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.