Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	SAUR1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50760 100 / 5e-27 SAUR-like auxin-responsive protein family (.1) AT5G20810 77 / 4e-18 SAUR-like auxin-responsive protein family (.1.2) AT3G43120 75 / 2e-17 SAUR-like auxin-responsive protein family (.1) AT2G46690 70 / 5e-16 SAUR-like auxin-responsive protein family (.1) AT3G61900 69 / 2e-15 SAUR-like auxin-responsive protein family (.1) AT1G56150 69 / 2e-15 SAUR-like auxin-responsive protein family (.1) AT2G24400 68 / 1e-14 SAUR-like auxin-responsive protein family (.1) AT4G31320 68 / 1e-14 SAUR-like auxin-responsive protein family (.1) AT3G12830 66 / 4e-14 SAUR-like auxin-responsive protein family (.1) AT1G16510 66 / 5e-14 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G060400 [exp] 295 / 4e-103 AT5G50760 71 / 5e-15 SAUR-like auxin-responsive protein family (.1) Potri.012G102700 [exp] 135 / 8e-41 AT5G50760 97 / 1e-25 SAUR-like auxin-responsive protein family (.1) Potri.006G137200 [exp] 76 / 1e-17 AT5G20810 201 / 1e-66 SAUR-like auxin-responsive protein family (.1.2) Potri.009G127100 [exp] 73 / 2e-17 AT5G18080 103 / 2e-30 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.015G006800 [exp] 73 / 5e-17 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1) Potri.012G023400 [exp] 73 / 6e-17 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1) Potri.006G278100 [exp] 72 / 3e-16 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.018G063400 [exp] 72 / 3e-16 AT5G20810 219 / 3e-74 SAUR-like auxin-responsive protein family (.1.2) Potri.008G003900 [exp] 71 / 4e-16 AT2G24400 110 / 1e-31 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011332 [exp] 145 / 6e-45 AT5G50760 99 / 3e-26 SAUR-like auxin-responsive protein family (.1) Lus10003140 [exp] 143 / 5e-44 AT5G50760 97 / 8e-26 SAUR-like auxin-responsive protein family (.1) Lus10034507 [exp] 74 / 7e-17 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1) Lus10034888 [exp] 73 / 2e-16 AT5G20810 210 / 2e-70 SAUR-like auxin-responsive protein family (.1.2) Lus10026977 [exp] 71 / 8e-16 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1) Lus10033161 [exp] 70 / 2e-15 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1) Lus10017018 [exp] 67 / 1e-14 AT2G36210 124 / 3e-37 SAUR-like auxin-responsive protein family (.1) Lus10012426 [exp] 67 / 2e-14 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1) Lus10042374 [exp] 66 / 3e-14 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1) Lus10026297 [exp] 66 / 8e-14 AT5G10990 125 / 2e-37 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.003G167400.1 pacid=42785971 polypeptide=Potri.003G167400.1.p locus=Potri.003G167400 ID=Potri.003G167400.1.v4.1 annot-version=v4.1 ATGGATGTGAGCAAGGGGAAAGGAAAGTTCAAAGGTAATCTGATCATCAAGACATGGGAGAGATGCATATCGTTTGGCAGGGGAAGCAAGAGAACGTCAA GACTGGAACGTTCTTTAACACCAAAGAGCAAATCATGCCCGCATATTAAAGTTTCACTTGAAGACGACCATGATCAAAAACATTCCAGGAAATCACGCGT AGCTCCTGAAGGTTGCTTCTCAGTCTACGTTGGACCCCAGAAACAAAGGTTTGTGATCAAGACAGAGTATGCAAACCACCCACTATTCAAGATTCTGCTT GAAGAAGCAGAGTCTGAGTATGGTTACAACCCTGAAGGCCCTCTAACACTACCCTGCAACGTTGATATCTTCTACAAAGTGTTGATGGCTATGGAGGACA CTGGTATTGATAACAAGATTCATCGCGGATGTAGCTTTGCCAAGAATTATGGATCTTATCACCTTCTTAGCCCATCGAGGATGATTGTTTTGAATCAGTT TTAA
AA sequence Show only first row Show all	>Potri.003G167400.1 pacid=42785971 polypeptide=Potri.003G167400.1.p locus=Potri.003G167400 ID=Potri.003G167400.1.v4.1 annot-version=v4.1 MDVSKGKGKFKGNLIIKTWERCISFGRGSKRTSRLERSLTPKSKSCPHIKVSLEDDHDQKHSRKSRVAPEGCFSVYVGPQKQRFVIKTEYANHPLFKILL EEAESEYGYNPEGPLTLPCNVDIFYKVLMAMEDTGIDNKIHRGCSFAKNYGSYHLLSPSRMIVLNQF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G50760			SAUR-like auxin-responsive pro...		Potri.003G167400 [exp]	0	1	SAUR1
					Potri.009G113550 [exp]	1.41	0.8512
AT1G23220			Dynein light chain type 1 fami...		Potri.011G120400 [exp]	3.00	0.8256
AT4G35160			O-methyltransferase family pro...		Potri.013G122000 [exp]	4.00	0.8577
AT2G46800		ATMTP1, ZAT1, Z...	ZINC TRANSPORTER OF ARABIDOPSI...		Potri.002G180100 [exp]	6.00	0.8434	PtrMTP2,Pt-MTP1.2
AT1G70520		ASG6, CRK2	ALTERED SEED GERMINATION 6, cy...		Potri.001G276600 [exp]	9.89	0.8339
AT1G49030			PLAC8 family protein (.1)		Potri.012G060900 [exp]	10.95	0.8407
AT5G47040		LON2	lon protease 2 (.1)		Potri.001G148400 [exp]	11.31	0.8270	LON.1
AT1G80490		TPR1	TOPLESS-related 1 (.1.2)		Potri.018G023900 [exp]	13.85	0.8170
AT1G66950		ABCG39, PDR11, ...	ATP-binding cassette G39, plei...		Potri.006G115000 [exp]	15.49	0.8395
AT3G57120			Protein kinase superfamily pro...		Potri.008G037401 [exp]	17.32	0.8046

Compare expression of checked genes

Potri.003G167400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.