Pt-NTF2.1 (Potri.003G170800) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-NTF2.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G27970 230 / 1e-79 NTF2B nuclear transport factor 2B (.1.2)
AT1G27310 219 / 3e-75 NTF2A nuclear transport factor 2A (.1)
AT1G11570 148 / 5e-47 NTL NTF2-like (.1.2)
AT1G13730 61 / 9e-12 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1)
AT5G48650 59 / 4e-11 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1)
AT5G60980 58 / 9e-11 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
AT3G25150 55 / 1e-09 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
AT2G03640 49 / 1e-07 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
AT3G07250 43 / 2e-05 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G057500 239 / 1e-83 AT1G27970 228 / 4e-79 nuclear transport factor 2B (.1.2)
Potri.011G025500 162 / 1e-52 AT1G11570 171 / 5e-56 NTF2-like (.1.2)
Potri.010G157800 64 / 1e-12 AT1G13730 219 / 4e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1)
Potri.008G096700 60 / 2e-11 AT2G03640 219 / 3e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Potri.002G246600 58 / 1e-10 AT3G25150 374 / 8e-125 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Potri.017G094600 57 / 1e-10 AT5G60980 286 / 6e-92 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Potri.015G058700 52 / 1e-08 AT5G60980 382 / 9e-129 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Potri.010G065500 44 / 6e-06 AT5G43960 310 / 3e-101 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Potri.002G257000 42 / 5e-05 AT5G43960 402 / 3e-137 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037033 232 / 1e-80 AT1G27970 231 / 5e-80 nuclear transport factor 2B (.1.2)
Lus10032033 226 / 4e-78 AT1G27970 227 / 1e-78 nuclear transport factor 2B (.1.2)
Lus10015772 185 / 1e-61 AT1G27310 188 / 9e-63 nuclear transport factor 2A (.1)
Lus10035202 179 / 1e-59 AT1G27310 184 / 1e-61 nuclear transport factor 2A (.1)
Lus10020061 153 / 3e-49 AT1G11570 171 / 3e-56 NTF2-like (.1.2)
Lus10006762 114 / 5e-34 AT1G11570 130 / 2e-40 NTF2-like (.1.2)
Lus10004644 62 / 4e-12 AT2G03640 253 / 2e-79 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Lus10026668 62 / 4e-12 AT2G03640 255 / 5e-80 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Lus10025906 59 / 8e-11 AT3G25150 363 / 4e-118 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Lus10037066 58 / 1e-10 AT2G03640 248 / 2e-77 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0051 NTF2 PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Representative CDS sequence
>Potri.003G170800.1 pacid=42786577 polypeptide=Potri.003G170800.1.p locus=Potri.003G170800 ID=Potri.003G170800.1.v4.1 annot-version=v4.1
ATGGATCCAGACACAGTAGCGAAGGCATTTGTTGAGCACTACTACAATATGTTCGATTCGAATAGAGCTGGGTTGGCGAATCTGTATCAAGACGCTTCCA
TGCTGACTTTTGAAGGTCAAAAGACTCAGGGATCCCAGAATATTGTAGCTAAACTAACTGCTCTTCCTTTTCATCAGTGCAAACATCACATCACTACCGT
TGATTGCCAGCCTTCTGGTCCTGCTGGTGGTATGCTTGTTTTCGTCTCCGGTAATCTCCAGCTCGCCGGCGAACAGCACGCTCTCAAGTTCAGCCAGATG
TTCCATTTGATGCCAACGCCACAGGGAAGCTATTATGTGTACAATGACATATTCAGGTTGAACTATGCTTGA
AA sequence
>Potri.003G170800.1 pacid=42786577 polypeptide=Potri.003G170800.1.p locus=Potri.003G170800 ID=Potri.003G170800.1.v4.1 annot-version=v4.1
MDPDTVAKAFVEHYYNMFDSNRAGLANLYQDASMLTFEGQKTQGSQNIVAKLTALPFHQCKHHITTVDCQPSGPAGGMLVFVSGNLQLAGEQHALKFSQM
FHLMPTPQGSYYVYNDIFRLNYA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G27970 NTF2B nuclear transport factor 2B (.... Potri.003G170800 0 1 Pt-NTF2.1
AT3G58170 ATBET11, ATBS14... ARABIDOPSIS THALIANA BET1P/SFT... Potri.005G221600 2.82 0.7849 BET11.1
AT3G61110 ARS27A ribosomal protein S27 (.1) Potri.001G069100 7.54 0.7652 Pt-ARS27.2
AT4G16695 unknown protein Potri.001G156500 8.77 0.7937
AT2G21290 unknown protein Potri.009G124700 11.22 0.7435
AT5G55640 unknown protein Potri.001G367200 14.14 0.7514
AT1G27970 NTF2B nuclear transport factor 2B (.... Potri.001G057500 18.00 0.7628
AT5G12320 ankyrin repeat family protein ... Potri.001G276100 18.02 0.7341
AT1G55300 TAF7 TBP-associated factor 7 (.1.2) Potri.003G218700 21.44 0.7172
AT4G13720 Inosine triphosphate pyrophosp... Potri.001G052400 24.89 0.7203
AT3G57785 unknown protein Potri.006G056900 25.45 0.6826

Potri.003G170800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.