Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27330 121 / 3e-38 Ribosome associated membrane protein RAMP4 (.1) AT1G27350 121 / 3e-38 Ribosome associated membrane protein RAMP4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G057300 [exp] 119 / 1e-37 AT1G27330 116 / 3e-36 Ribosome associated membrane protein RAMP4 (.1) Potri.006G017100 [exp] 117 / 1e-36 AT1G27330 119 / 2e-37 Ribosome associated membrane protein RAMP4 (.1) Potri.016G008600 [exp] 103 / 4e-31 AT1G27330 72 / 2e-18 Ribosome associated membrane protein RAMP4 (.1) Potri.001G057150 [exp] 99 / 3e-29 AT1G27330 99 / 4e-29 Ribosome associated membrane protein RAMP4 (.1) Potri.003G171250 [exp] 72 / 6e-19 AT1G27330 73 / 2e-19 Ribosome associated membrane protein RAMP4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037031 [exp] 120 / 8e-38 AT1G27350 120 / 6e-38 Ribosome associated membrane protein RAMP4 (.1) Lus10011355 [exp] 105 / 7e-32 AT1G27350 108 / 2e-33 Ribosome associated membrane protein RAMP4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06624 [poplar] [flax] RAMP4 Ribosome associated membrane protein RAMP4
Representative CDS sequence Show only first row Show all	>Potri.003G171100.1 pacid=42785771 polypeptide=Potri.003G171100.1.p locus=Potri.003G171100 ID=Potri.003G171100.1.v4.1 annot-version=v4.1 ATGACTACATCAAGGCGTCTTGCTGATAGGAAAGTCAATAGATTTGACAAGAACATTTCTAGGAGAGGAGCTGTGCCCGAAACAACCACGAAAAAGGGAA ATGACTATCCCGTTGGTCCTCTTCTCCTTGGATTCTTCATCTTTGTTGTCATTGGATCATCTCTATTCCAGATAATCAGGACAGCCACAGACGGAGGCAT GGCCTAA
AA sequence Show only first row Show all	>Potri.003G171100.1 pacid=42785771 polypeptide=Potri.003G171100.1.p locus=Potri.003G171100 ID=Potri.003G171100.1.v4.1 annot-version=v4.1 MTTSRRLADRKVNRFDKNISRRGAVPETTTKKGNDYPVGPLLLGFFIFVVIGSSLFQIIRTATDGGMA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G27330			Ribosome associated membrane p...		Potri.003G171100 [exp]	0	1
AT3G22845			emp24/gp25L/p24 family/GOLD fa...		Potri.010G081700 [exp]	3.74	0.8723
AT3G60540			Preprotein translocase Sec, Se...		Potri.014G059000 [exp]	4.47	0.8656	SEC61.3
AT1G69460			emp24/gp25L/p24 family/GOLD fa...		Potri.010G164600 [exp]	12.44	0.7951
AT2G47470		ATPDI11, ATPDIL...	UNFERTILIZED EMBRYO SAC 5, MAT...		Potri.014G122800 [exp]	13.85	0.8211
AT5G61310			Cytochrome c oxidase subunit V...		Potri.002G195901 [exp]	20.63	0.8367
AT4G30996		NKS1	NA\(+\)- AND K\(+\)-SENSITIVE ...		Potri.018G111100 [exp]	21.63	0.8034
AT5G42020		BIP2, BIP	luminal binding protein, Heat ...		Potri.001G087500 [exp]	25.09	0.8001	Pt-BIP.2
AT1G04980		ATPDI10, ATPDIL...	ARABIDOPSIS THALIANA PROTEIN D...		Potri.014G160000 [exp]	25.84	0.8326
AT5G03160		ATP58IPK	homolog of mamallian P58IPK (....		Potri.016G088600 [exp]	27.16	0.7870
AT2G36900		ATMEMB11, MEMB1...	membrin 11 (.1.2)		Potri.013G062900 [exp]	36.98	0.8203

Compare expression of checked genes

Potri.003G171100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.