Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04280 80 / 9e-21 ARR22 response regulator 22 (.1.2.3) AT5G26594 75 / 1e-18 ARR24 response regulator 24 (.1) AT2G17820 48 / 1e-07 AHK1, ATHK1 histidine kinase 1 (.1) AT5G10720 39 / 0.0001 CKI2, AHK5 CYTOKININ INDEPENDENT 2, histidine kinase 5 (.1) AT2G01830 38 / 0.0004 CRE1, AHK4, WOL1, WOL, ATCRE1 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G172866 [exp] 164 / 3e-50 AT3G04280 85 / 2e-19 response regulator 22 (.1.2.3) Potri.003G172800 [exp] 160 / 3e-49 AT3G04280 76 / 2e-16 response regulator 22 (.1.2.3) Potri.003G177400 [exp] 149 / 1e-46 AT3G04280 99 / 9e-26 response regulator 22 (.1.2.3) Potri.003G177300 [exp] 146 / 9e-46 AT3G04280 96 / 8e-25 response regulator 22 (.1.2.3) Potri.001G051000 [exp] 106 / 3e-29 AT5G26594 82 / 7e-19 response regulator 24 (.1) Potri.019G025000 [exp] 100 / 6e-29 AT5G26594 117 / 2e-34 response regulator 24 (.1) Potri.001G050800 [exp] 99 / 2e-27 AT5G26594 77 / 4e-18 response regulator 24 (.1) Potri.019G024900 [exp] 96 / 6e-27 AT5G26594 121 / 2e-36 response regulator 24 (.1) Potri.001G050900 [exp] 100 / 1e-26 AT3G04280 83 / 4e-19 response regulator 22 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004775 [exp] 90 / 8e-25 AT5G26594 98 / 2e-27 response regulator 24 (.1) Lus10005407 [exp] 64 / 3e-14 AT5G26594 135 / 2e-41 response regulator 24 (.1) Lus10028021 [exp] 60 / 1e-12 AT5G26594 99 / 3e-27 response regulator 24 (.1) Lus10031600 [exp] 47 / 3e-07 AT2G47430 624 / 0.0 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10033746 [exp] 44 / 2e-06 AT2G47430 615 / 0.0 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10041891 [exp] 43 / 7e-06 AT2G17820 1561 / 0.0 histidine kinase 1 (.1) Lus10028992 [exp] 42 / 1e-05 AT2G01830 1337 / 0.0 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3) Lus10003686 [exp] 42 / 1e-05 AT2G01830 1330 / 0.0 WOODEN LEG 1, WOODEN LEG, CYTOKININ RESPONSE 1, ARABIDOPSIS HISTIDINE KINASE 4, CHASE domain containing histidine kinase protein (.1.2.3) Lus10035114 [exp] 42 / 1e-05 AT2G47430 132 / 2e-34 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10028438 [exp] 42 / 2e-05 AT2G17820 1553 / 0.0 histidine kinase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0304 [poplar] [flax] CheY PF00072 [poplar] [flax] Response_reg Response regulator receiver domain
Representative CDS sequence Show only first row Show all	>Potri.003G172750.1 pacid=42786783 polypeptide=Potri.003G172750.1.p locus=Potri.003G172750 ID=Potri.003G172750.1.v4.1 annot-version=v4.1 ATGCCAGTTGGGACAGAAAAGCATCGTGCAATGGAATTTCAAGAGGCGAAGAATGGGAAAGAAGCTGTTTATCTTCATCTTGCCGGGGCTTCTTTTGATC TCATTATTATGGACAATCAAATGCCCATCATGACTGGAATTCAGGCAACACAGCTGCTACGTAAGATGGGTGTTAAGAGTCCGATTATAGGTGTCACTTC TGAGTCTGACCACCAAGCTTTCATCGACGCTGGCGCCGACGAATGCCTTAAAATGCCACTGGATACTGCATAG
AA sequence Show only first row Show all	>Potri.003G172750.1 pacid=42786783 polypeptide=Potri.003G172750.1.p locus=Potri.003G172750 ID=Potri.003G172750.1.v4.1 annot-version=v4.1 MPVGTEKHRAMEFQEAKNGKEAVYLHLAGASFDLIIMDNQMPIMTGIQATQLLRKMGVKSPIIGVTSESDHQAFIDAGADECLKMPLDTA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G04280		ARR22	response regulator 22 (.1.2.3)		Potri.003G172750 [exp]	0	1
					Potri.008G036350 [exp]	3.74	0.6870
					Potri.015G106750 [exp]	8.48	0.6756
					Potri.001G276104 [exp]	13.41	0.6170
AT2G15530			RING/U-box superfamily protein...		Potri.011G103401 [exp]	16.12	0.5405
AT1G57775			Protein of unknown function (D...		Potri.004G114901 [exp]	21.35	0.5109
AT4G27330	NZZ	NZZ, SPL	NOZZLE, sporocyteless (SPL) (....		Potri.001G409000 [exp]	27.45	0.4805
AT3G55260		HEXO1, ATHEX2	beta-hexosaminidase 1 (.1)		Potri.008G049801 [exp]	27.96	0.5147
AT1G79400		ATCHX2	cation/H+ exchanger 2, cation/...		Potri.003G194100 [exp]	28.77	0.4330	ATCHX1.2
AT5G23280	TCP	TCP7	TCP family transcription facto...		Potri.009G009400 [exp]	33.86	0.4300
					Potri.001G227800 [exp]	42.07	0.5847

Compare expression of checked genes

Potri.003G172750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.