Pt-TOM20.2 (Potri.003G173400) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-TOM20.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G27080 208 / 1e-68 TOM20-3 translocase of outer membrane 20 kDa subunit 3 (.1)
AT1G27390 207 / 3e-68 TOM20-2 translocase outer membrane 20-2 (.1)
AT5G40930 176 / 3e-56 TOM20-4 translocase of outer membrane 20-4 (.1)
AT3G27070 163 / 5e-51 TOM20-1 translocase outer membrane 20-1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G054900 337 / 2e-119 AT1G27390 230 / 4e-77 translocase outer membrane 20-2 (.1)
Potri.001G330200 227 / 4e-76 AT1G27390 215 / 3e-71 translocase outer membrane 20-2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012532 228 / 4e-70 AT3G01910 616 / 0.0 sulfite oxidase (.1.2.3)
Lus10035211 209 / 2e-68 AT3G27080 210 / 1e-68 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10032045 208 / 3e-68 AT3G27080 211 / 2e-69 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10011363 174 / 4e-55 AT3G27080 180 / 1e-57 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10006419 174 / 5e-55 AT3G27080 180 / 1e-57 translocase of outer membrane 20 kDa subunit 3 (.1)
Lus10041558 78 / 5e-18 AT3G27080 83 / 5e-20 translocase of outer membrane 20 kDa subunit 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF06552 TOM20_plant Plant specific mitochondrial import receptor subunit TOM20
Representative CDS sequence
>Potri.003G173400.2 pacid=42786292 polypeptide=Potri.003G173400.2.p locus=Potri.003G173400 ID=Potri.003G173400.2.v4.1 annot-version=v4.1
ATGGAGTTCTCTCAAGATGACTTTGATCGTCTATTAAGGTTCGAGCACACTCGAAAATCCGCCGAAGCTACCTACGCTAAAGACCCTCTTGATGCCGACA
ACTTGACTAAGTGGGGCGAGGCATTGCTCGAACTATCACAATTTCAAACCGTGGCAGAGGCAAAGAAGATGATAAATGAGGCTATTTCGAAGTTGGAAGA
GGCAATGATGTTAAATCCAACAGCCAATGCCATGTGGTCAATAGGAAATGCCAACACTTCTTATGCATTTCTGACTCCCGATCTTTCTGAGGCAAAAAAT
TATTTTGACAAGGCAGCTGATTACTTCCAACAAGCGGTTGATGAGGACTCGACCAACGAGCTTTACCACAAGTCTTTGGAAGTTTGTGCTAAGGCTCCAG
AATTGCATATGGAGATCCATAAGCATTCAAGCAGTCAACAGACCATGGGTGGTGAATCTTCTCCTTCTTCAAATGCAAAGGGCTCCAAGAAGAAGGCAAA
CAGTGATCTGAAGTATGATATATTTGGATGGATTATCCTTGCAGTTGGAATCGTTGCATGGATGGGGATTGCAAAATCCCATGTTCCTCCTCCTCCAATA
TAA
AA sequence
>Potri.003G173400.2 pacid=42786292 polypeptide=Potri.003G173400.2.p locus=Potri.003G173400 ID=Potri.003G173400.2.v4.1 annot-version=v4.1
MEFSQDDFDRLLRFEHTRKSAEATYAKDPLDADNLTKWGEALLELSQFQTVAEAKKMINEAISKLEEAMMLNPTANAMWSIGNANTSYAFLTPDLSEAKN
YFDKAADYFQQAVDEDSTNELYHKSLEVCAKAPELHMEIHKHSSSQQTMGGESSPSSNAKGSKKKANSDLKYDIFGWIILAVGIVAWMGIAKSHVPPPPI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G27080 TOM20-3 translocase of outer membrane ... Potri.003G173400 0 1 Pt-TOM20.2
AT3G12390 Nascent polypeptide-associated... Potri.001G034400 2.44 0.9624
AT5G25757 RNA polymerase I-associated fa... Potri.018G038500 4.24 0.9405
AT5G60390 GTP binding Elongation factor ... Potri.008G042700 5.47 0.9540 Pt-ADR12.2
AT3G62870 Ribosomal protein L7Ae/L30e/S1... Potri.017G101000 5.74 0.9569 Pt-RPL7.7
AT2G34480 Ribosomal protein L18ae/LX fam... Potri.002G057600 5.83 0.9574 RPL18.7
AT3G52590 HAP4, ERD16, UB... HAPLESS 4, EARLY-RESPONSIVE TO... Potri.016G077000 7.93 0.9493 UBQ1.1
AT2G20420 ATP citrate lyase (ACL) family... Potri.002G259600 9.74 0.9396
AT1G43170 RPL3A, ARP1, EM... embryo defective 2207, ribosom... Potri.005G194500 10.58 0.9547 ARP1.1
AT5G28060 Ribosomal protein S24e family ... Potri.008G152500 11.74 0.9534
AT1G62440 LRX2 leucine-rich repeat/extensin 2... Potri.006G081200 14.14 0.9229

Potri.003G173400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.