Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G24020 315 / 2e-109 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT4G13580 313 / 1e-108 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G07730 144 / 5e-41 Disease resistance-responsive (dirigent-like protein) family protein (.2) AT2G28670 139 / 2e-40 ESB1 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) AT2G39430 131 / 2e-36 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G55230 124 / 6e-34 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G65870 68 / 9e-14 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42510 65 / 1e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42500 62 / 8e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G58090 62 / 4e-11 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G054000 [exp] 375 / 5e-133 AT3G24020 352 / 5e-124 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G054100 [exp] 329 / 2e-114 AT4G13580 308 / 3e-106 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.008G049200 [exp] 156 / 4e-46 AT2G28670 276 / 2e-90 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.010G211800 [exp] 150 / 5e-44 AT2G28670 257 / 6e-83 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.010G211900 [exp] 131 / 7e-36 AT2G39430 249 / 3e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.008G049100 [exp] 126 / 7e-34 AT2G39430 251 / 6e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.010G212000 [exp] 84 / 2e-19 AT1G07730 103 / 1e-25 Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.016G060801 [exp] 64 / 1e-12 AT1G58170 164 / 5e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.008G061400 [exp] 64 / 3e-12 AT2G21110 223 / 7e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023689 [exp] 319 / 9e-111 AT3G24020 336 / 1e-117 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10011767 [exp] 317 / 9e-110 AT3G24020 339 / 7e-119 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10006317 [exp] 154 / 9e-46 AT2G28670 271 / 1e-89 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Lus10029585 [exp] 129 / 1e-37 AT2G28670 166 / 6e-53 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Lus10030318 [exp] 101 / 1e-25 AT3G55230 276 / 2e-93 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10003301 [exp] 97 / 7e-23 AT3G55230 254 / 2e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10016231 [exp] 65 / 9e-13 AT1G65870 149 / 8e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10021084 [exp] 62 / 2e-11 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025804 [exp] 61 / 4e-11 AT1G22900 116 / 7e-33 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10021083 [exp] 57 / 1e-09 AT1G22900 150 / 5e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [poplar] [flax] AOC_barrel PF03018 [poplar] [flax] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Potri.003G174300.1 pacid=42786772 polypeptide=Potri.003G174300.1.p locus=Potri.003G174300 ID=Potri.003G174300.1.v4.1 annot-version=v4.1 ATGTTGAAGCTATCATCTCCATATGTTTTCATTGCAGTGCTAATTGCTGCCCTACACACAGCAATATATGTGGCTGCCATCGAACCAGTACCAGCTGGAG GAGAGCCTGTTCTTGAGCTGTACATGCATGACATTCTAGGGGGCAGTAACCCTACAGCAAGGCCAATCACTGGTTTGCTAGGGAACATATATAGTGGCCA AGTACCCTTTGCAAGGCCAGTAGGATTCGTTCCTCCAAAAGGTGCAGTTGCCATCCCCAATGCCAATGGTGCCCTTCCAACTGTTAATGGTCTCAATGGC ATTCCACTAGGTACTGGCTTGGCTGGTACGACTTTTGCAGGAAATCCTAATGGTCAGAACACAAATGGTCAGATCCAAACCCAACTTGGACCAGACGGAT TGGGACTAGGCTTTGGAACGATCACTGTCATCGATGACACTTTGACCAACAGCCCTGAGTTAGGGTCACAACAACTGGGAAAAGCTCAAGGAGTTTATGT GGCTAGTTCTGCAGATGGGAGCACACAGATGATGGCATTTACAGCCATGTTTGAAGGGGGAGAATTTGGTGATAGCCTAAACTTTTATGGCATATACAGG ATTGGTAGCGCAATGTCACGTTTGTCGGTGACTGGAGGAACGGGCAAGTTTAAGAATGCTATCGGGTTTGCTGAAGTACGAGGACTTATCCCACCAGGTC AAGCAGTCACGGATGGTGCAGAAACATTACTGAGGATCTCTGTCCATTTGAAATACTAA
AA sequence Show only first row Show all	>Potri.003G174300.1 pacid=42786772 polypeptide=Potri.003G174300.1.p locus=Potri.003G174300 ID=Potri.003G174300.1.v4.1 annot-version=v4.1 MLKLSSPYVFIAVLIAALHTAIYVAAIEPVPAGGEPVLELYMHDILGGSNPTARPITGLLGNIYSGQVPFARPVGFVPPKGAVAIPNANGALPTVNGLNG IPLGTGLAGTTFAGNPNGQNTNGQIQTQLGPDGLGLGFGTITVIDDTLTNSPELGSQQLGKAQGVYVASSADGSTQMMAFTAMFEGGEFGDSLNFYGIYR IGSAMSRLSVTGGTGKFKNAIGFAEVRGLIPPGQAVTDGAETLLRISVHLKY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G24020			Disease resistance-responsive ...		Potri.003G174300 [exp]	0	1
AT2G27370		CASP3	Casparian strip membrane domai...		Potri.009G160000 [exp]	1.00	0.9842
AT2G39430			Disease resistance-responsive ...		Potri.008G049100 [exp]	1.41	0.9839
AT3G24020			Disease resistance-responsive ...		Potri.001G054000 [exp]	2.82	0.9716
AT2G43390			unknown protein		Potri.007G130200 [exp]	4.24	0.9722
AT5G06200		CASP4	Casparian strip membrane domai...		Potri.016G075400 [exp]	5.29	0.9654
AT2G18210			unknown protein		Potri.007G022200 [exp]	7.07	0.9679
AT1G61590			Protein kinase superfamily pro...		Potri.001G128500 [exp]	8.94	0.9652
AT1G49000			unknown protein		Potri.010G130600 [exp]	9.16	0.9675
AT5G44550			Uncharacterised protein family...		Potri.001G442300 [exp]	10.00	0.9628
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Potri.016G021100 [exp]	10.39	0.9647

Compare expression of checked genes

Potri.003G174300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.