Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G24060 46 / 7e-07 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G053200 [exp] 195 / 2e-65 AT3G24060 56 / 1e-10 Plant self-incompatibility protein S1 family (.1) Potri.003G175100 [exp] 124 / 2e-37 ND / Potri.002G263900 [exp] 115 / 8e-34 AT3G24060 46 / 5e-07 Plant self-incompatibility protein S1 family (.1) Potri.001G053300 [exp] 55 / 2e-10 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1) Potri.003G175200 [exp] 52 / 2e-09 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1) Potri.001G053100 [exp] 49 / 5e-08 AT3G24060 171 / 2e-55 Plant self-incompatibility protein S1 family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011754 [exp] 53 / 1e-09 AT3G24060 152 / 1e-48 Plant self-incompatibility protein S1 family (.1) Lus10023675 [exp] 47 / 3e-07 AT3G24060 162 / 3e-52 Plant self-incompatibility protein S1 family (.1) Lus10029388 [exp] 47 / 3e-07 AT5G04350 55 / 3e-10 Plant self-incompatibility protein S1 family (.1) Lus10029375 [exp] 47 / 5e-07 AT5G04347 62 / 4e-13 Plant self-incompatibility protein S1 family (.1) Lus10016350 [exp] 41 / 5e-05 AT2G06090 59 / 1e-11 Plant self-incompatibility protein S1 family (.1) Lus10017719 [exp] 41 / 6e-05 AT3G24060 157 / 4e-50 Plant self-incompatibility protein S1 family (.1) Lus10000682 [exp] 40 / 0.0001 AT4G16295 56 / 4e-10 S-protein homologue 1 (.1) Lus10021633 [exp] 40 / 0.0001 AT4G29035 57 / 4e-11 Plant self-incompatibility protein S1 family (.1) Lus10000558 [exp] 38 / 0.0004 AT4G16295 55 / 1e-10 S-protein homologue 1 (.1) Lus10021634 [exp] 38 / 0.0006 AT4G29035 58 / 4e-11 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [poplar] [flax] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Potri.003G175000.2 pacid=42785106 polypeptide=Potri.003G175000.2.p locus=Potri.003G175000 ID=Potri.003G175000.2.v4.1 annot-version=v4.1 ATGATGACTTCTTGGATCAACTTTCTTCTCTTCCTTGTTCTCCAACTGTGCTTTTTGAGTACTGCAACAACAAATGAGCATGATGACCATCCTTTACCCA CTGTTTACGTTATCAATGCCTTGCCTAAAAGCTCAAAAGCAATGAATGTCAGCTGCTCATCCAACAATATTGATATCGGAGAGCAGTCACTCGTTAATGG TGAAGTCTACAAATGGAGGGTGTCAAAGAGGAAGCTACACTACTGTGTAGCTATCTGGGAAAGATTTTTTGCATCCTGGCATGCATTTCAACCTCGTAGA GATGGGAATCATGAAACTCTGTTTTGGATGGTGGAAGAAGATGGGTTCTTTATTAGCTGGGATAAAGCCAAGTGGGTGAGAAAATACAGATGGGAAACTG AGTGA
AA sequence Show only first row Show all	>Potri.003G175000.2 pacid=42785106 polypeptide=Potri.003G175000.2.p locus=Potri.003G175000 ID=Potri.003G175000.2.v4.1 annot-version=v4.1 MMTSWINFLLFLVLQLCFLSTATTNEHDDHPLPTVYVINALPKSSKAMNVSCSSNNIDIGEQSLVNGEVYKWRVSKRKLHYCVAIWERFFASWHAFQPRR DGNHETLFWMVEEDGFFISWDKAKWVRKYRWETE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G24060			Plant self-incompatibility pro...		Potri.003G175000 [exp]	0	1
AT4G33010		ATGLDP1	glycine decarboxylase P-protei...		Potri.018G053720 [exp]	6.24	0.8437
AT2G38152			alpha 1,4-glycosyltransferase ...		Potri.006G098900 [exp]	6.92	0.8379
AT4G36220		CYP84A1, FAH1, ...	ferulic acid 5-hydroxylase 1 (...		Potri.009G123600 [exp]	13.71	0.8044	/F5H2,Pt-IFS1.57
AT5G54160		ATOMT1	O-methyltransferase 1 (.1)		Potri.015G003100 [exp]	25.41	0.8154	COMT1,Pt-OMT1.2
AT4G36930	bHLH	SPT, bHLH024	SPATULA, basic helix-loop-heli...		Potri.005G139700 [exp]	25.61	0.8417
AT5G35770		SAP	STERILE APETALA, Transducin/WD...		Potri.014G166400 [exp]	29.69	0.8094	SAP.1
					Potri.001G020080 [exp]	31.30	0.8266
					Potri.011G073216 [exp]	32.58	0.8338
AT1G20140		ASK4	SKP1-like 4 (.1)		Potri.009G135800 [exp]	34.17	0.8259	SKP1.4
					Potri.002G048450 [exp]	36.33	0.8197

Compare expression of checked genes

Potri.003G175000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.