Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3) AT2G32070 467 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT5G10960 421 / 4e-150 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G15920 352 / 4e-123 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2) AT3G44260 278 / 5e-94 AtCAF1a CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT5G22250 271 / 4e-91 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G06450 169 / 2e-50 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G61470 130 / 4e-36 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT3G44240 121 / 3e-33 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) AT1G27820 119 / 1e-31 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G046700 [exp] 539 / 0 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.018G020900 [exp] 478 / 6e-173 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.006G262500 [exp] 476 / 3e-172 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.006G187200 [exp] 419 / 2e-149 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.004G200400 [exp] 305 / 1e-104 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.009G161500 [exp] 298 / 7e-102 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.016G073000 [exp] 278 / 8e-94 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.006G205600 [exp] 276 / 8e-93 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Potri.001G040400 [exp] 235 / 3e-77 AT5G22250 253 / 4e-84 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017123 [exp] 471 / 6e-170 AT2G32070 447 / 1e-160 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10018330 [exp] 469 / 5e-169 AT2G32070 444 / 3e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10003635 [exp] 453 / 6e-163 AT2G32070 435 / 6e-156 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10036291 [exp] 452 / 2e-162 AT2G32070 432 / 9e-155 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10034180 [exp] 293 / 7e-100 AT5G22250 410 / 4e-146 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10004212 [exp] 280 / 3e-94 AT3G44260 336 / 1e-116 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10021304 [exp] 273 / 2e-91 AT5G22250 335 / 8e-116 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10016980 [exp] 269 / 5e-89 AT5G22250 332 / 8e-114 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10017905 [exp] 163 / 3e-48 AT1G06450 162 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1) Lus10001651 [exp] 164 / 8e-48 AT1G61470 167 / 4e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0219 [poplar] [flax] RNase_H PF04857 [poplar] [flax] CAF1 CAF1 family ribonuclease
Representative CDS sequence Show only first row Show all	>Potri.003G181100.2 pacid=42786468 polypeptide=Potri.003G181100.2.p locus=Potri.003G181100 ID=Potri.003G181100.2.v4.1 annot-version=v4.1 ATGTCGCTGTTGCCGAAAGGTGATTCCATTCACATTCGTGAGGTGTGGAATGACAATCTCGAAGAAGAATTCGCGCTTATCCGTGAAATTGTTGATGATT TCCCTTATATTGCCATGGACACTGAGTTTCCGGGCATTGTGCTGCGTCCGGTGGGTAATTTTAAGAATAGTAATGACTATCATTACCAAACTTTGAAGGA TAATGTGGACGTGTTGAAGTTGATTCAACTGGGTCTTACCTTTTCAGATGATCAAGGGAATTTACCAACTTGTGGCACTGATAAGTATTGCATTTGGCAG TTTAATTTCCGCGAGTTCAATGTGAATGAGGATGTTTTTGCAAATGACTCGATTGAGCTTTTGCGTCAGAGTGGGATTGACTTAAATAAGAACAATGAAA ATGGTATTGATGCTGTGAGATTTGGTGAGCTCTTGATGTCGTCTGGGATTGTGTTGAATGATAGTGTGTACTGGGTGACTTTTCATAGTGGTTATGATTT TGGGTACTTGCTTAAGCTGTTGACATGCCAGAATTTACCAGATACACAAGCCGGGTTCTTTAATTTGATCAACATGTACTTTCCAACTCTTTATGATATC AAGCATTTGATGAAGTTTTGCAATAGCCTTCATGGAGGGTTGAACAAGCTTGCAGAGTTGTTAGAAGTGGAGAGAATTGGGATATGCCATCAAGCAGGTT CGGATAGTTTGCTTACAGCTTGTACATTCAGGAAATTGAAAGAAAATTTCTTTAGCTGCTCATTGGAAAAATATGCCGGTGTGTTGTATGGTTTAGGTGT CGAGAATGGACAAATTACTCATTGA
AA sequence Show only first row Show all	>Potri.003G181100.2 pacid=42786468 polypeptide=Potri.003G181100.2.p locus=Potri.003G181100 ID=Potri.003G181100.2.v4.1 annot-version=v4.1 MSLLPKGDSIHIREVWNDNLEEEFALIREIVDDFPYIAMDTEFPGIVLRPVGNFKNSNDYHYQTLKDNVDVLKLIQLGLTFSDDQGNLPTCGTDKYCIWQ FNFREFNVNEDVFANDSIELLRQSGIDLNKNNENGIDAVRFGELLMSSGIVLNDSVYWVTFHSGYDFGYLLKLLTCQNLPDTQAGFFNLINMYFPTLYDI KHLMKFCNSLHGGLNKLAELLEVERIGICHQAGSDSLLTACTFRKLKENFFSCSLEKYAGVLYGLGVENGQITH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G80780			Polynucleotidyl transferase, r...		Potri.003G181100 [exp]	0	1
AT1G74210		AtGDPD5	glycerophosphodiester phosphod...		Potri.015G058400 [exp]	2.00	0.7554
AT2G47590		PHR2	photolyase/blue-light receptor...		Potri.014G128500 [exp]	4.00	0.6932
AT5G01650			Tautomerase/MIF superfamily pr...		Potri.006G104600 [exp]	4.58	0.7241
AT5G56540		ATAGP14, AGP14	arabinogalactan protein 14 (.1...		Potri.003G220900 [exp]	7.74	0.6776
AT5G07960			unknown protein		Potri.012G065500 [exp]	13.07	0.6909
AT2G38560		RDO2, TFIIS	REDUCED DORMANCY 2, transcript...		Potri.006G109300 [exp]	21.35	0.7301
AT3G07270			GTP cyclohydrolase I (.1.2)		Potri.002G247100 [exp]	52.44	0.6893
AT4G05150			Octicosapeptide/Phox/Bem1p fam...		Potri.004G032200 [exp]	57.96	0.6190
AT1G75388		CPuORF5	conserved peptide upstream ope...		Potri.005G231250 [exp]	60.45	0.6058
AT3G61600		ATPOB1	POZ/BTB containin G-protein 1 ...		Potri.003G135300 [exp]	91.65	0.5969

Compare expression of checked genes

Potri.003G181100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.