Potri.003G182400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G80860 207 / 4e-70 ATPLMT ARABIDOPSIS PHOSPHOLIPID N-METHYLTRANSFERASE, phospholipid N-methyltransferase (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G044200 221 / 2e-75 AT1G80860 279 / 7e-98 ARABIDOPSIS PHOSPHOLIPID N-METHYLTRANSFERASE, phospholipid N-methyltransferase (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026087 184 / 4e-61 AT1G80860 262 / 5e-91 ARABIDOPSIS PHOSPHOLIPID N-METHYLTRANSFERASE, phospholipid N-methyltransferase (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0115 Steroid_dh PF04191 PEMT Phospholipid methyltransferase
Representative CDS sequence
>Potri.003G182400.2 pacid=42786984 polypeptide=Potri.003G182400.2.p locus=Potri.003G182400 ID=Potri.003G182400.2.v4.1 annot-version=v4.1
ATGGACTATGTTTCACATTTCCTCAAGTTGTTGCAGTTCATTTCTCTTTTTTCAGTTTCCACTCTCTCTTGGCCGCCTCCTCTCTACTTCTGGCCCCTCT
TTGGCTTTGGTCAGTTCCTCAACTTCAGGGTATACCAATTGCTTGGTGAAGCTGGTACTTACTATGGTGTACGCTTTGGGAAGAATGTCCCCTGGGTGAC
AGAGTTCCCATTCGGGGTTATAAGAGATCCACAGTATGTTGGAAGCGTTCTGAGTCTTTTTGCATGTCTATCTTGGGTCCCTTTCCAATACGTTCTCTTG
TGGACTCTGGGCTATGTATTCATGATCCACCTGGAATCAAAGGAGGATCCTTAA
AA sequence
>Potri.003G182400.2 pacid=42786984 polypeptide=Potri.003G182400.2.p locus=Potri.003G182400 ID=Potri.003G182400.2.v4.1 annot-version=v4.1
MDYVSHFLKLLQFISLFSVSTLSWPPPLYFWPLFGFGQFLNFRVYQLLGEAGTYYGVRFGKNVPWVTEFPFGVIRDPQYVGSVLSLFACLSWVPFQYVLL
WTLGYVFMIHLESKEDP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G80860 ATPLMT ARABIDOPSIS PHOSPHOLIPID N-MET... Potri.003G182400 0 1
AT4G35830 ACO1 aconitase 1 (.1.2) Potri.015G130201 3.16 0.8701
AT4G30993 Calcineurin-like metallo-phosp... Potri.018G110300 5.00 0.8496
Potri.001G332601 8.48 0.8322
AT4G08460 Protein of unknown function (D... Potri.005G172300 8.94 0.8644
AT1G33265 Transmembrane proteins 14C (.1... Potri.011G147000 9.48 0.8305
AT2G15880 Leucine-rich repeat (LRR) fami... Potri.004G146350 11.22 0.8078
AT3G16240 DELTA-TIP1, ATT... delta tonoplast integral prote... Potri.003G050900 11.95 0.8190 Pt-TIP2.3
AT5G47540 Mo25 family protein (.1) Potri.016G011300 14.42 0.8432
AT5G60440 MADS AGL62 AGAMOUS-like 62 (.1) Potri.004G002400 17.88 0.8081
AT5G03260 LAC11 laccase 11 (.1) Potri.004G156400 18.76 0.8069

Potri.003G182400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.