Potri.003G182801 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G73060 70 / 5e-16 LPA3 Low PSII Accumulation 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G044000 77 / 1e-18 AT1G73060 529 / 0.0 Low PSII Accumulation 3 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026089 68 / 3e-15 AT1G73060 472 / 1e-167 Low PSII Accumulation 3 (.1)
Lus10002315 67 / 5e-15 AT1G73060 499 / 4e-177 Low PSII Accumulation 3 (.1)
PFAM info
Representative CDS sequence
>Potri.003G182801.1 pacid=42785831 polypeptide=Potri.003G182801.1.p locus=Potri.003G182801 ID=Potri.003G182801.1.v4.1 annot-version=v4.1
ATGTTCATCCTTTATATCTTCTATGCAGTAACTGATGATGGGCCTTGGCAGGTGATGCTTAAAAAAGCAGATGGCTCATACTCTTGTGTAGCAGAGAGTG
TGACGCGCTTCACACTTGGTGAGTCTGCCACTTGGGAGGAAGAAGATGTTGAACTTGAAACATCTTCTGATTGGCGCAGTTGA
AA sequence
>Potri.003G182801.1 pacid=42785831 polypeptide=Potri.003G182801.1.p locus=Potri.003G182801 ID=Potri.003G182801.1.v4.1 annot-version=v4.1
MFILYIFYAVTDDGPWQVMLKKADGSYSCVAESVTRFTLGESATWEEEDVELETSSDWRS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G73060 LPA3 Low PSII Accumulation 3 (.1) Potri.003G182801 0 1
AT5G43580 UPI UNUSUAL SERINE PROTEASE INHIBI... Potri.011G110400 6.92 0.7356
AT2G40390 unknown protein Potri.010G183100 9.32 0.7616
AT5G43580 UPI UNUSUAL SERINE PROTEASE INHIBI... Potri.011G110100 25.45 0.7042
AT1G28440 HSL1 HAESA-like 1 (.1) Potri.017G016600 30.41 0.7404
AT3G08570 Phototropic-responsive NPH3 fa... Potri.016G139900 37.73 0.7309
Potri.010G104000 39.54 0.7045
AT1G02170 AtMCP1b, ATMC1,... LSD ONE LIKE 3, ARABIDOPSIS TH... Potri.017G052900 40.55 0.7344
Potri.019G017150 47.81 0.7169
AT4G12390 PME1 pectin methylesterase inhibito... Potri.003G113700 53.66 0.7023
AT5G13710 CPH, SMT1 CEPHALOPOD, sterol methyltrans... Potri.016G056000 59.44 0.6907

Potri.003G182801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.