Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G80500 266 / 1e-93 SNARE-like superfamily protein (.1) AT2G20930 56 / 1e-10 SNARE-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G043400 [exp] 274 / 1e-96 AT1G80500 264 / 8e-93 SNARE-like superfamily protein (.1) Potri.009G136800 [exp] 57 / 5e-11 AT2G20930 264 / 1e-92 SNARE-like superfamily protein (.1) Potri.004G176500 [exp] 47 / 2e-07 AT2G20930 163 / 3e-53 SNARE-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041670 [exp] 148 / 2e-46 AT1G80500 145 / 2e-45 SNARE-like superfamily protein (.1) Lus10024068 [exp] 149 / 1e-43 AT1G15950 534 / 0.0 IRREGULAR XYLEM 4, cinnamoyl coa reductase 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0431 [poplar] [flax] PF PF04099 [poplar] [flax] Sybindin Sybindin-like family
Representative CDS sequence Show only first row Show all	>Potri.003G183400.9 pacid=42785334 polypeptide=Potri.003G183400.9.p locus=Potri.003G183400 ID=Potri.003G183400.9.v4.1 annot-version=v4.1 ATGGCAACCACAGCTTGTTTTATAATTGTGAGCAGGAATGATATCCCTATATATGAAGCTGAAGTTGGATCTGCTACTAAAAGGGAAGATGCTGCACAGA TGCATCAATTTATATTGCATGCAGCTTTGGATATTGTTCAGGATCTTGCATGGACCACCAGCGCCATGTATTTGAAGGCAATTGACAGGTTTAATGATAT GGTGGTGTCAGTTTATGTTACAGCTGGTCATACGAGATTTATGCTACTTCATGACTCTCGCAATGATGATGGAATCAAGAGCTTTTTCCAGGAGGTTCAT GAGCTGTATATAAAGATTCTTCTCAACCCCCTATACTTGCCTGGTTCCCGCATTACATCTTCGCATTTTGACACCAAAGTTCGGGCTCTTGCAAGAAAAT ACCTATAG
AA sequence Show only first row Show all	>Potri.003G183400.9 pacid=42785334 polypeptide=Potri.003G183400.9.p locus=Potri.003G183400 ID=Potri.003G183400.9.v4.1 annot-version=v4.1 MATTACFIIVSRNDIPIYEAEVGSATKREDAAQMHQFILHAALDIVQDLAWTTSAMYLKAIDRFNDMVVSVYVTAGHTRFMLLHDSRNDDGIKSFFQEVH ELYIKILLNPLYLPGSRITSSHFDTKVRALARKYL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G80500			SNARE-like superfamily protein...		Potri.003G183400 [exp]	0	1
AT1G77710			unknown protein		Potri.002G087200 [exp]	1.00	0.8958
AT5G47890			NADH-ubiquinone oxidoreductase...		Potri.003G159100 [exp]	1.73	0.8698
AT4G29735			unknown protein		Potri.006G146800 [exp]	2.44	0.8735
AT5G61310			Cytochrome c oxidase subunit V...		Potri.014G120500 [exp]	2.44	0.8512
AT4G22310			Uncharacterised protein family...		Potri.011G023100 [exp]	2.82	0.8623
AT5G25940			early nodulin-related (.1)		Potri.019G033700 [exp]	3.74	0.8477
AT5G17190			unknown protein		Potri.008G133600 [exp]	6.00	0.8273
AT4G30010			unknown protein		Potri.006G075600 [exp]	10.95	0.8545
AT3G05100			S-adenosyl-L-methionine-depend...		Potri.013G034000 [exp]	10.95	0.8314
AT2G24765		ARF3, ARL1, ATA...	ARF-LIKE 1, ADP-ribosylation f...		Potri.018G013700 [exp]	11.66	0.8070

Compare expression of checked genes

Potri.003G183400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.