Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	J8.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G80920 131 / 4e-39 AtToc12, AtJ8, J8 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) AT2G41000 53 / 5e-09 Chaperone DnaJ-domain superfamily protein (.1.2) AT5G59610 52 / 3e-08 Chaperone DnaJ-domain superfamily protein (.1.2) AT2G33735 49 / 6e-08 Chaperone DnaJ-domain superfamily protein (.1) AT3G08970 50 / 2e-07 TMS1, ATERDJ3A THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) AT1G72070 48 / 2e-07 Chaperone DnaJ-domain superfamily protein (.1) AT1G79940 50 / 3e-07 ATERDJ2A DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4) AT3G62600 49 / 4e-07 ATERDJ3B DNAJ heat shock family protein (.1) AT5G16650 47 / 4e-07 Chaperone DnaJ-domain superfamily protein (.1) AT4G21180 49 / 5e-07 ATERDJ2B DnaJ / Sec63 Brl domains-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G043100 [exp] 203 / 1e-67 AT1G80920 129 / 2e-38 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Potri.016G120000 [exp] 58 / 4e-10 AT3G08970 479 / 6e-164 THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) Potri.001G072700 [exp] 54 / 5e-09 AT5G59610 254 / 3e-84 Chaperone DnaJ-domain superfamily protein (.1.2) Potri.014G122600 [exp] 52 / 5e-08 AT3G62600 565 / 0.0 DNAJ heat shock family protein (.1) Potri.013G058100 [exp] 50 / 2e-07 AT5G18140 264 / 1e-86 Chaperone DnaJ-domain superfamily protein (.1) Potri.006G024700 [exp] 48 / 3e-07 AT2G41000 125 / 2e-36 Chaperone DnaJ-domain superfamily protein (.1.2) Potri.004G072200 [exp] 49 / 4e-07 AT1G79940 1087 / 0.0 DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4) Potri.019G041400 [exp] 47 / 5e-07 AT5G16650 193 / 5e-65 Chaperone DnaJ-domain superfamily protein (.1) Potri.017G148800 [exp] 49 / 6e-07 AT1G79940 1062 / 0.0 DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014352 [exp] 127 / 1e-37 AT1G80920 135 / 2e-41 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Lus10041671 [exp] 125 / 4e-37 AT1G80920 138 / 2e-42 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Lus10026061 [exp] 120 / 7e-35 AT1G80920 136 / 1e-41 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Lus10024067 [exp] 118 / 5e-34 AT1G80920 130 / 4e-39 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Lus10016510 [exp] 59 / 9e-11 AT5G59610 252 / 2e-83 Chaperone DnaJ-domain superfamily protein (.1.2) Lus10003380 [exp] 59 / 1e-10 AT3G08970 615 / 0.0 THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) Lus10002852 [exp] 59 / 2e-10 AT3G08970 600 / 0.0 THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) Lus10040777 [exp] 57 / 6e-10 AT5G59610 246 / 6e-81 Chaperone DnaJ-domain superfamily protein (.1.2) Lus10004491 [exp] 52 / 2e-08 AT2G41000 152 / 4e-47 Chaperone DnaJ-domain superfamily protein (.1.2) Lus10039293 [exp] 52 / 4e-08 AT1G79940 1086 / 0.0 DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [poplar] [flax] Chaperone-J PF00226 [poplar] [flax] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Potri.003G183700.1 pacid=42786390 polypeptide=Potri.003G183700.1.p locus=Potri.003G183700 ID=Potri.003G183700.1.v4.1 annot-version=v4.1 ATGGCAAGTGCAGCAGCTGTTGGGATGATGGGAGGAAATGGGGGTGCTGTGTCCTCGAGCTCTTGGTTTCAAATCAAGAACAGGAGGAAGAAGAACAATA AAGATAATATGGGGAGAGATAGAGTCAGGACTTTTTGTGCTTCTTCCTATTCATCTTCTTCTTCTTCTTCTGTTATGGACCCTTATAAGACTCTTAAGAT CCAACCTGGTGCTTCTGAGTCTGAGGTCAAGAAAGCTTTTAGACAGCTTGCTCTGCAGTATCATCCAGATGTATGCAGAGGAAGCAATTGTGGTGTACAG TTTAGTCTGATCAATGAAGCCTATGATATTGTGATGAGTAATTTGAGGGAAGAACCAGATGAATCATCACAGATGTACAGGTCTTATGAGCCATCGGATC AAGGAATTGATGAGCCTATGAGAGGAATGAACGATCCAGATTGGGATATGTGGGAAGAATGGATGGGGTGGGAAGGAGCTGGGATTCGTGACTACTCATC TCATATTAATCCTTACATTTAA
AA sequence Show only first row Show all	>Potri.003G183700.1 pacid=42786390 polypeptide=Potri.003G183700.1.p locus=Potri.003G183700 ID=Potri.003G183700.1.v4.1 annot-version=v4.1 MASAAAVGMMGGNGGAVSSSSWFQIKNRRKKNNKDNMGRDRVRTFCASSYSSSSSSSVMDPYKTLKIQPGASESEVKKAFRQLALQYHPDVCRGSNCGVQ FSLINEAYDIVMSNLREEPDESSQMYRSYEPSDQGIDEPMRGMNDPDWDMWEEWMGWEGAGIRDYSSHINPYI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G80920		AtToc12, AtJ8, ...	translocon at the outer envelo...		Potri.003G183700 [exp]	0	1	J8.2
AT5G43150			unknown protein		Potri.010G088200 [exp]	14.66	0.7455
AT5G45360			F-box family protein (.1)		Potri.004G236200 [exp]	16.00	0.6790
AT2G21270		UFD1	ubiquitin fusion degradation 1...		Potri.004G163200 [exp]	17.77	0.7255
AT2G40320		TBL33	TRICHOME BIREFRINGENCE-LIKE 33...		Potri.008G073300 [exp]	19.18	0.7285
AT4G39080		VHA-A3	vacuolar proton ATPase A3 (.1)		Potri.009G121400 [exp]	21.54	0.6496
AT3G51150			ATP binding microtubule motor ...		Potri.005G116900 [exp]	21.70	0.7265
AT1G06130		GLX2-4	glyoxalase 2-4 (.1.2)		Potri.007G131300 [exp]	25.39	0.7232	GLX2.2
AT5G42690			Protein of unknown function, D...		Potri.014G034800 [exp]	31.62	0.7136
					Potri.001G131500 [exp]	34.64	0.6914
AT1G03790	C3HZnF	SOM	SOMNUS, Zinc finger C-x8-C-x5-...		Potri.007G138300 [exp]	35.32	0.7147

Compare expression of checked genes

Potri.003G183700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.