Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37580 121 / 4e-34 RING/U-box superfamily protein (.1) AT1G35330 72 / 4e-15 RING/U-box superfamily protein (.1) AT4G09120 71 / 2e-14 RING/U-box superfamily protein (.1) AT4G09130 71 / 2e-14 RING/U-box superfamily protein (.1) AT4G09110 70 / 3e-14 RING/U-box superfamily protein (.1) AT1G72220 70 / 5e-14 RING/U-box superfamily protein (.1) AT2G35420 68 / 6e-14 RING/U-box superfamily protein (.1) AT2G42350 67 / 9e-14 RING/U-box superfamily protein (.1) AT1G72310 68 / 1e-13 ATL3 RING/U-box superfamily protein (.1) AT5G47610 66 / 1e-13 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G144200 [exp] 84 / 3e-20 AT5G17600 90 / 3e-21 RING/U-box superfamily protein (.1) Potri.010G206200 [exp] 76 / 2e-17 AT5G17600 91 / 6e-22 RING/U-box superfamily protein (.1) Potri.009G073900 [exp] 73 / 1e-15 AT5G58580 102 / 9e-26 TOXICOS EN LEVADURA 63 (.1) Potri.013G073500 [exp] 74 / 2e-15 AT3G03550 262 / 2e-85 RING/U-box superfamily protein (.1) Potri.008G054200 [exp] 70 / 5e-15 AT1G20823 80 / 6e-19 RING/U-box superfamily protein (.1) Potri.013G157000 [exp] 69 / 8e-15 AT3G10910 114 / 1e-32 RING/U-box superfamily protein (.1) Potri.001G141200 [exp] 71 / 1e-14 AT5G17600 207 / 1e-63 RING/U-box superfamily protein (.1) Potri.001G162000 [exp] 71 / 1e-14 AT1G53820 149 / 2e-43 RING/U-box superfamily protein (.1) Potri.002G101800 [exp] 71 / 1e-14 AT1G72220 195 / 3e-58 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029456 [exp] 76 / 6e-18 AT5G10380 86 / 3e-21 RING/U-box superfamily protein (.1) Lus10005954 [exp] 75 / 7e-16 AT3G04020 111 / 7e-28 unknown protein Lus10025338 [exp] 72 / 8e-16 AT4G17905 99 / 4e-25 RING/U-box superfamily protein (.1) Lus10024405 [exp] 69 / 2e-14 AT4G17905 95 / 9e-24 RING/U-box superfamily protein (.1) Lus10036380 [exp] 67 / 4e-14 AT5G05280 96 / 2e-25 RING/U-box superfamily protein (.1) Lus10033515 [exp] 68 / 7e-14 AT1G49230 224 / 6e-74 RING/U-box superfamily protein (.1) Lus10020859 [exp] 68 / 1e-13 AT1G49230 230 / 3e-76 RING/U-box superfamily protein (.1) Lus10015901 [exp] 68 / 2e-13 AT1G72220 175 / 3e-51 RING/U-box superfamily protein (.1) Lus10037490 [exp] 68 / 3e-13 AT3G16720 224 / 2e-70 TOXICOS EN LEVADURA 2 (.1) Lus10042277 [exp] 66 / 3e-13 AT3G16720 104 / 2e-26 TOXICOS EN LEVADURA 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.003G184800.2 pacid=42786759 polypeptide=Potri.003G184800.2.p locus=Potri.003G184800 ID=Potri.003G184800.2.v4.1 annot-version=v4.1 ATGGAGCATCCACCAACCATCTTCATGGTACCTGAACCCCCACCTTTCCCTGCACCGCCAAGGAGTGTAGATTTAGCCCCTCTTGAATTCATTCTTGCAT TCATAGCTGTTATCGCCGTTCCCGCTCTGATCTACACCTTTTTCTTCTCTATCAAGTGCCCTCCTGGCCCCTTCAGGAGGAGGAGGCGTCACCGAAGCAG CAGTTCCATCATCTCTGAAACCCTTTCTGTCTCTGAAATTGTTGATACCGACGACTTAAACGGTACAACGAGCGGTGATCAGAAAGAGCGGGTTTCAGAT GTTAAGTTTCAGAAAGACACGCATTTGCAGGATGTTGGAAGTGAATGTCCAGTTTGTTTGTCTGTGTTTTCTGATGGGGAAGCAGTGAAGCAACTAAGTG TGTGCAAGCACTCCTTTCATGCTTCTTGTATTGATATGTGGCTCAGTTCTAACTCAAATTGTCCTGTCTGTCGGGCTTCTACTGCCCCTCCTGCCAAGCA TCCTGGTAAGAATCCCTCCTCTTCAACATCTAGAAATAATGTTGACGATCTCCAGCAAGGATTGCCGGATGCGGCGAGTTTGGTTTGA
AA sequence Show only first row Show all	>Potri.003G184800.2 pacid=42786759 polypeptide=Potri.003G184800.2.p locus=Potri.003G184800 ID=Potri.003G184800.2.v4.1 annot-version=v4.1 MEHPPTIFMVPEPPPFPAPPRSVDLAPLEFILAFIAVIAVPALIYTFFFSIKCPPGPFRRRRRHRSSSSIISETLSVSEIVDTDDLNGTTSGDQKERVSD VKFQKDTHLQDVGSECPVCLSVFSDGEAVKQLSVCKHSFHASCIDMWLSSNSNCPVCRASTAPPAKHPGKNPSSSTSRNNVDDLQQGLPDAASLV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G37580			RING/U-box superfamily protein...		Potri.003G184800 [exp]	0	1
AT1G09630		ATRAB-A2A, ATRA...	ARABIDOPSIS RAB GTPASE A2A, RA...		Potri.003G004100 [exp]	11.74	0.8100
AT4G38790			ER lumen protein retaining rec...		Potri.004G167400 [exp]	11.83	0.7673
AT4G32530			ATPase, F0/V0 complex, subunit...		Potri.006G248700 [exp]	14.76	0.8158
AT5G18900			2-oxoglutarate (2OG) and Fe(II...		Potri.008G197700 [exp]	19.10	0.7973
AT3G23325			Splicing factor 3B subunit 5/R...		Potri.010G070500 [exp]	19.33	0.7698
AT4G38510			ATPase, V1 complex, subunit B ...		Potri.009G137800 [exp]	19.67	0.7813
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Potri.009G028200 [exp]	21.49	0.8129	Pt-ADF1.1
AT5G09810		ACT2/7, ACT7	actin 7 (.1)		Potri.001G309500 [exp]	24.85	0.7898	Pt-PEAC14.1,ACT1
AT1G01630			Sec14p-like phosphatidylinosit...		Potri.001G068000 [exp]	43.95	0.7468
AT5G24400		PGL3, EMB2024	6-PHOSPHOGLUCONOLACTONASE 3, E...		Potri.015G007200 [exp]	45.56	0.7094

Compare expression of checked genes

Potri.003G184800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.