Plant FIBer expression Database

Potri.003G185401 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G16070 56 / 5e-10 TUB AtTLP8 tubby like protein 8 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G041400
[exp]
110 / 9e-30 AT1G16070 436 / 3e-152 tubby like protein 8 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041617
[exp]
70 / 5e-15 AT1G16070 416 / 2e-144 tubby like protein 8 (.1.2)
Lus10024102
[exp]
69 / 9e-15 AT1G16070 422 / 3e-146 tubby like protein 8 (.1.2)
PFAM info
Representative CDS sequence
>Potri.003G185401.1 pacid=42785145 polypeptide=Potri.003G185401.1.p locus=Potri.003G185401 ID=Potri.003G185401.1.v4.1 annot-version=v4.1
ATGCAGTGCCCAAAAATTCAAAACCTTTGTCTACAGATGGGTCTCTCTGCTTTGCCAAAGCCACAGTTAACCAACATGAAGTCTTTGTCAACTGGCAGAG
TCTTAAAGCCTTCTTCTTTACAGTTGTGTGTGCAAATGAATGAGCCTGAAAAGGTTTTCAAGTCTAGAGTTTGGAACTCTGTTCAGTCTGAGAATTCAAG
TTCTGTTAATATCTGGGACTATTCAGATGCTGAGGATACTCCTACATCTTCTTGGTCTACATTGCCCAATAGAATTCAAGCCAAAATATTGCCAAGTTTA
AATTTTTCAAACTCGAGTACTGAGATGTTGTCTTGGCTAGGATTTGGGATTTATAGCTTCTGCGTACCTGGTTAA
AA sequence
>Potri.003G185401.1 pacid=42785145 polypeptide=Potri.003G185401.1.p locus=Potri.003G185401 ID=Potri.003G185401.1.v4.1 annot-version=v4.1
MQCPKIQNLCLQMGLSALPKPQLTNMKSLSTGRVLKPSSLQLCVQMNEPEKVFKSRVWNSVQSENSSSVNIWDYSDAEDTPTSSWSTLPNRIQAKILPSL
NFSNSSTEMLSWLGFGIYSFCVPG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Download tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G16070 TUB AtTLP8 tubby like protein 8 (.1.2) Potri.003G185401
[exp]
0 1
AT4G12340 copper ion binding (.1) Potri.003G114200
[exp]
51.87 0.5309
AT5G20180 Ribosomal protein L36 (.1.2) Potri.006G069000
[exp]
54.86 0.6072
AT3G54400 Eukaryotic aspartyl protease f... Potri.003G195500
[exp]
78.16 0.6121
AT2G33570 Domain of unknown function (DU... Potri.005G258900
[exp]
124.31 0.6193
AT4G35720 Arabidopsis protein of unknown... Potri.005G103800
[exp]
127.24 0.5646
AT3G13870 GOM8, RHD3 GOLGI MUTANT 8, Root hair defe... Potri.003G038900
[exp]
242.49 0.5447

Potri.003G185401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.