Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G73110 77 / 7e-18 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G39730 41 / 3e-05 RCA rubisco activase (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G037300 [exp] 94 / 5e-24 AT1G73110 663 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.008G058500 [exp] 42 / 2e-05 AT2G39730 803 / 0.0 rubisco activase (.1.2.3) Potri.010G200500 [exp] 40 / 6e-05 AT2G39730 797 / 0.0 rubisco activase (.1.2.3) Potri.016G101100 [exp] 37 / 0.0005 AT2G39730 696 / 0.0 rubisco activase (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041627 [exp] 81 / 3e-19 AT1G73110 639 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10003234 [exp] 41 / 3e-05 AT2G39730 757 / 0.0 rubisco activase (.1.2.3) Lus10010868 [exp] 41 / 4e-05 AT2G39730 642 / 0.0 rubisco activase (.1.2.3) Lus10035616 [exp] 39 / 0.0002 AT2G39730 362 / 5e-124 rubisco activase (.1.2.3) Lus10024092 [exp] 36 / 0.0006 AT1G73110 52 / 4e-09 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.003G187601.1 pacid=42785814 polypeptide=Potri.003G187601.1.p locus=Potri.003G187601 ID=Potri.003G187601.1.v4.1 annot-version=v4.1 ATGAGCATATCAGCAGGTGCAGAAGGAAGTTTACGCTTGTCCATCACATTGAAGTCCTGTTTTTTGCCATTGTGGGTTGATGATATTGAAGGTGTTGAAA ATCTAGGTAAAAGACTTCTCCAGCGAAGAAAGGACGAGAAACTTCCTGTGTTTACTCCTCCAGAGCAAACAGTGGAGGCTTTGCTTGAATCAGGATACTC TCTCATCAAAGAGCACCAGCTAATTATAGAGACCAGTGTTTGGTATAGTGATAGCTTTTCCGATTGTGGTTTGAAAAGGCAGGTTTGA
AA sequence Show only first row Show all	>Potri.003G187601.1 pacid=42785814 polypeptide=Potri.003G187601.1.p locus=Potri.003G187601 ID=Potri.003G187601.1.v4.1 annot-version=v4.1 MSISAGAEGSLRLSITLKSCFLPLWVDDIEGVENLGKRLLQRRKDEKLPVFTPPEQTVEALLESGYSLIKEHQLIIETSVWYSDSFSDCGLKRQV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G73110			P-loop containing nucleoside t...		Potri.003G187601 [exp]	0	1
AT1G15370			SNARE-like superfamily protein...		Potri.006G253700 [exp]	13.71	0.7196
AT3G48700		ATCXE13	carboxyesterase 13 (.1)		Potri.009G104200 [exp]	18.49	0.8194
AT3G30530	bZIP	ATBZIP42	basic leucine-zipper 42 (.1)		Potri.017G106700 [exp]	21.90	0.8050
AT4G17565			F-box family protein with a do...		Potri.004G134900 [exp]	22.80	0.8143
AT1G53200			unknown protein		Potri.012G106300 [exp]	24.57	0.6705
AT1G43760			DNAse I-like superfamily prote...		Potri.014G188801 [exp]	27.56	0.8110
AT1G67320		EMB2813	EMBRYO DEFECTIVE 2813, DNA pri...		Potri.017G053801 [exp]	28.37	0.8066
					Potri.006G040201 [exp]	36.00	0.8039
AT5G27650			Tudor/PWWP/MBT superfamily pro...		Potri.008G209900 [exp]	38.57	0.7209
AT4G30880			Bifunctional inhibitor/lipid-t...		Potri.009G048900 [exp]	51.84	0.8014

Compare expression of checked genes

Potri.003G187601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.