Potri.003G189300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07900 178 / 6e-52 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 136 / 4e-36 Mitochondrial transcription termination factor family protein (.1)
AT5G64950 129 / 2e-33 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 109 / 2e-26 Mitochondrial transcription termination factor family protein (.1.2)
AT3G46950 101 / 2e-23 Mitochondrial transcription termination factor family protein (.1)
AT1G62120 100 / 5e-23 Mitochondrial transcription termination factor family protein (.1)
AT1G62010 98 / 2e-22 Mitochondrial transcription termination factor family protein (.1)
AT1G62085 95 / 5e-21 Mitochondrial transcription termination factor family protein (.1)
AT1G61960 94 / 1e-20 Mitochondrial transcription termination factor family protein (.1)
AT1G61990 92 / 2e-20 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G034500 369 / 1e-126 AT5G07900 208 / 2e-63 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034600 370 / 2e-126 AT5G07900 197 / 4e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.004G222000 365 / 4e-125 AT5G07900 200 / 1e-60 Mitochondrial transcription termination factor family protein (.1)
Potri.001G035000 366 / 5e-125 AT5G07900 209 / 7e-64 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034700 359 / 2e-122 AT5G07900 202 / 2e-61 Mitochondrial transcription termination factor family protein (.1)
Potri.001G034933 355 / 5e-121 AT5G07900 194 / 3e-58 Mitochondrial transcription termination factor family protein (.1)
Potri.001G030300 354 / 2e-120 AT5G07900 190 / 2e-56 Mitochondrial transcription termination factor family protein (.1)
Potri.001G035200 348 / 2e-118 AT5G07900 168 / 3e-48 Mitochondrial transcription termination factor family protein (.1)
Potri.003G190700 346 / 2e-117 AT5G07900 213 / 3e-65 Mitochondrial transcription termination factor family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008688 299 / 8e-99 AT5G07900 197 / 2e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10036450 156 / 1e-43 AT5G07900 176 / 3e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 153 / 1e-42 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 152 / 4e-42 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 140 / 7e-38 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10028912 138 / 8e-37 AT5G64950 249 / 1e-79 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 137 / 1e-36 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10004329 136 / 2e-36 AT5G64950 238 / 2e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10041122 133 / 4e-35 AT5G07900 166 / 2e-47 Mitochondrial transcription termination factor family protein (.1)
Lus10002883 115 / 3e-28 AT5G07900 196 / 9e-59 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Potri.003G189300.1 pacid=42786881 polypeptide=Potri.003G189300.1.p locus=Potri.003G189300 ID=Potri.003G189300.1.v4.1 annot-version=v4.1
ATGGCCACGAATATATCCTCCACGGGAAACCTCATTTCTTTTATACAAAAACGTTTTCTATTAACATCAGCAGCAGCAACAGTAACACTTTCTCCCAACT
CTCCACTACCCACTACTACTAGTTGTAGCTCCTCCTCCTCTTCTTCTACGGCCCAATTCCTCGTCAATTCATGCGGTCTTTCTCTGCAATCTGCTCTTTC
AGTTTCTAAAAAGTTCCAAATCCATGAGAATGATCTCCATAAGCTCCGATCTGTTGTCCAATTCATGAAAGCTCATGGTTTTAGCGAGACCCACCTGGCC
AAATTGATCCAAAGTCGGCCAGGAGTTCTCCATTGCAGAGTAGAAGGTAATCTCAAACCCAAATTTGAATTTCTCACAGAGAATGGCGTTGTGGGTCAGC
TTCTGCCAGAGCTCATTTTATCAAATACTCATATTTTAAGAAGGGGTTTAGATTCTCAAATTAAACCATGTTTTGAGTTTTTAAAGTCTGTTCTTGGTTG
CAATGAGAACGTTTTGGTGGCTCTTAAACATTCTTCTTGGCTGTTGACGTTGCGTTTGAAGGGCACTATGCAACCAAATTATGATTTGTTGATAGAAGAG
GGAGTGGCTGTTGATAGGATTGCTAAACTGATTATGATGGACCCAAGAGCCATACAGAATAAGCGTGATAAAATGATTTCTACAGTGAGTACTCTCAAGG
ATTTAGGCCTTGAACCAAATGCTCCTGTTTTTATACACGCTCTTAGAGCGATGTTATCTATCAGTGAATCGACTCGGAAGAAGAAAATTGAGGTGCTGAA
GAGTTTGGGTTGGAGTGAGAAAGATATTTGGCATGCCTTTAAGCGACATCCTCTTCTTTTGGGATATTCAGAGGAGAAAATCAGGGCTGGGATGGATTTT
TTTGTGAATACATTGAAGTTGGGATTGCAACATGTGATTGCCTGCCCCCAGCTTCTTACTTATTCTATTGATAAAAGGTTGCTTCCCAGGTATAATGTTT
TAAAGATTTTGGAGTCAAAGAAGCTGATTAAAAAGGATTTGAAGATTAAGAATTTGCTTAAAATAAATGAGAAGGAATTCTTGAAGAATTATGTTTACAA
GTATGTGGACGATATTCCAGGGTTGTTGGATTTATATGGAGGAGCCGACAAAGCAAAAAAGATACACTTGATGACGGAGAAGTAA
AA sequence
>Potri.003G189300.1 pacid=42786881 polypeptide=Potri.003G189300.1.p locus=Potri.003G189300 ID=Potri.003G189300.1.v4.1 annot-version=v4.1
MATNISSTGNLISFIQKRFLLTSAAATVTLSPNSPLPTTTSCSSSSSSSTAQFLVNSCGLSLQSALSVSKKFQIHENDLHKLRSVVQFMKAHGFSETHLA
KLIQSRPGVLHCRVEGNLKPKFEFLTENGVVGQLLPELILSNTHILRRGLDSQIKPCFEFLKSVLGCNENVLVALKHSSWLLTLRLKGTMQPNYDLLIEE
GVAVDRIAKLIMMDPRAIQNKRDKMISTVSTLKDLGLEPNAPVFIHALRAMLSISESTRKKKIEVLKSLGWSEKDIWHAFKRHPLLLGYSEEKIRAGMDF
FVNTLKLGLQHVIACPQLLTYSIDKRLLPRYNVLKILESKKLIKKDLKIKNLLKINEKEFLKNYVYKYVDDIPGLLDLYGGADKAKKIHLMTEK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G07900 Mitochondrial transcription te... Potri.003G189300 0 1
AT4G26965 NADH:ubiquinone oxidoreductase... Potri.001G109600 1.41 0.8466
AT5G09540 Chaperone DnaJ-domain superfam... Potri.007G114800 4.89 0.7993
AT3G61610 Galactose mutarotase-like supe... Potri.001G095300 8.36 0.7940
AT5G52380 VASCULAR-RELATED NAC-DOMAIN 6 ... Potri.015G144600 8.48 0.8033
AT3G06920 Tetratricopeptide repeat (TPR)... Potri.010G014100 9.21 0.8198
AT1G51580 RNA-binding KH domain-containi... Potri.010G251700 9.48 0.7890
AT5G19420 Regulator of chromosome conden... Potri.001G276900 10.09 0.7901
AT4G32400 EMB42, EMB104, ... SODIUM HYPERSENSITIVE 1, EMBRY... Potri.018G029200 10.67 0.7673
AT1G30290 Tetratricopeptide repeat (TPR)... Potri.011G082300 11.57 0.8508
AT1G20370 Pseudouridine synthase family ... Potri.002G014400 14.69 0.8351

Potri.003G189300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.