Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38730 349 / 2e-124 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT2G21130 203 / 3e-67 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G62030 202 / 8e-66 CYP20-3, ROC4 cyclophilin 20-3, rotamase CYP 4 (.1.2.3) AT2G16600 199 / 1e-65 ROC3 rotamase CYP 3 (.1.2) AT3G56070 197 / 6e-65 ROC2 rotamase cyclophilin 2 (.1.2) AT4G38740 194 / 1e-63 ROC1 rotamase CYP 1 (.1) AT4G34870 186 / 2e-60 ATCYP1, ROC5 ARABIDOPSIS THALIANA CYCLOPHILIN 1, rotamase cyclophilin 5 (.1) AT3G55920 180 / 2e-57 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G63400 184 / 3e-57 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) AT2G29960 178 / 5e-57 CYP19-4, ATCYP5, CYP5 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G030000 [exp] 376 / 1e-135 AT2G38730 348 / 5e-124 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.009G130100 [exp] 206 / 1e-68 AT2G21130 279 / 1e-97 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.002G021500 [exp] 205 / 4e-68 AT2G16600 278 / 2e-97 rotamase CYP 3 (.1.2) Potri.005G240200 [exp] 203 / 3e-67 AT2G16600 276 / 2e-96 rotamase CYP 3 (.1.2) Potri.004G168800 [exp] 203 / 4e-67 AT2G16600 278 / 4e-97 rotamase CYP 3 (.1.2) Potri.002G185200 [exp] 200 / 1e-64 AT3G62030 293 / 2e-100 cyclophilin 20-3, rotamase CYP 4 (.1.2.3) Potri.019G014396 [exp] 193 / 2e-63 AT3G56070 277 / 1e-96 rotamase cyclophilin 2 (.1.2) Potri.005G215800 [exp] 196 / 3e-59 AT3G63400 252 / 2e-77 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) Potri.004G144300 [exp] 186 / 4e-58 AT2G15790 590 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026161 [exp] 356 / 4e-127 AT2G38730 346 / 5e-123 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10008662 [exp] 352 / 1e-125 AT2G38730 342 / 2e-121 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10007579 [exp] 205 / 5e-68 AT2G16600 311 / 2e-110 rotamase CYP 3 (.1.2) Lus10012167 [exp] 202 / 7e-67 AT2G16600 313 / 4e-111 rotamase CYP 3 (.1.2) Lus10017258 [exp] 196 / 3e-64 AT2G16600 308 / 6e-109 rotamase CYP 3 (.1.2) Lus10022012 [exp] 190 / 6e-62 AT3G56070 295 / 1e-103 rotamase cyclophilin 2 (.1.2) Lus10042553 [exp] 189 / 1e-61 AT3G56070 297 / 1e-104 rotamase cyclophilin 2 (.1.2) Lus10013552 [exp] 188 / 2e-61 AT2G16600 297 / 1e-104 rotamase CYP 3 (.1.2) Lus10011330 [exp] 185 / 8e-59 AT5G13120 336 / 2e-117 Photosynthetic NDH subcomplex L 5, ARABIDOPSIS THALIANA CYCLOPHILIN 20-2, cyclophilin 20-2 (.1.2) Lus10018238 [exp] 183 / 8e-59 AT2G29960 348 / 4e-124 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0475 [poplar] [flax] Cyclophil-like PF00160 [poplar] [flax] Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
Representative CDS sequence Show only first row Show all	>Potri.003G194500.7 pacid=42785054 polypeptide=Potri.003G194500.7.p locus=Potri.003G194500 ID=Potri.003G194500.7.v4.1 annot-version=v4.1 ATGGCGTCAGGAGGAGGAGGAGGGAGTGTAGAGTGGCACTTGAGACCACCAAACCCTAAAAACCCAATCGTCTTCTTCGATGTTACAATCGGTACCATCC CTGCTGGTCGTATCAAAATGGAGCTCTTCGCTGATATTGCCCCTAAAACCGCCGAAAATTTCAGGCAGTTTTGCACAGGCGAGTACAGAAAAGCTGGATT ACCTGTTGGTTACAAAGTATGTCAATTTCATAGAGTGATTAAGGATTTTATGATTCAAGCTGGTGATTTTCTCAAGGGTGATGGTAGTGGTTGTGTTTCT ATTTATGGGCTTAAGTTTGAGGATGAAAATTTTGTTGCCAAACATACCGGCCCTGGTCTACTTTCAATGGCAAATAGTGGGCCAAATACCAATGGTTGTC AGTTTTTCATCACTTGTGCAAAATGCGACTGGCTTGACAATAAGCATGTTGTATTTGGGAGGGTGCTTGGAGATGGTCTTTTGGTTATTCGAAAGATAGA GAATGTGGCAACAGGACCCAACAACCGACCAAAACTGCCATGTGTTATTGCAGAATGCGGAGAAATGTAG
AA sequence Show only first row Show all	>Potri.003G194500.7 pacid=42785054 polypeptide=Potri.003G194500.7.p locus=Potri.003G194500 ID=Potri.003G194500.7.v4.1 annot-version=v4.1 MASGGGGGSVEWHLRPPNPKNPIVFFDVTIGTIPAGRIKMELFADIAPKTAENFRQFCTGEYRKAGLPVGYKVCQFHRVIKDFMIQAGDFLKGDGSGCVS IYGLKFEDENFVAKHTGPGLLSMANSGPNTNGCQFFITCAKCDWLDNKHVVFGRVLGDGLLVIRKIENVATGPNNRPKLPCVIAECGEM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G38730			Cyclophilin-like peptidyl-prol...		Potri.003G194500 [exp]	0	1
AT5G61030		GR-RBP3	glycine-rich RNA-binding prote...		Potri.012G061600 [exp]	2.23	0.9053
AT1G08970	CCAAT	NF-YC9, HAP5C	"nuclear factor Y, subunit C9"...		Potri.010G032301 [exp]	2.44	0.8837
AT4G25630		ATFIB2, FIB2	fibrillarin 2 (.1)		Potri.012G144800 [exp]	4.58	0.8599
AT2G20142			Toll-Interleukin-Resistance (T...		Potri.018G023600 [exp]	4.89	0.8275
AT5G43960			Nuclear transport factor 2 (NT...		Potri.014G192900 [exp]	5.19	0.8831
AT5G60340			P-loop containing nucleoside t...		Potri.012G109400 [exp]	5.47	0.8441
					Potri.006G264900 [exp]	6.48	0.8140
AT3G23280		XBAT35	XB3 ortholog 5 in Arabidopsis ...		Potri.018G011300 [exp]	7.07	0.8664
AT5G67260		CYCD3;2	CYCLIN D3;2 (.1)		Potri.007G048300 [exp]	7.14	0.8400	Pt-CYCD3.3
AT5G22540			Plant protein of unknown funct...		Potri.004G187100 [exp]	7.74	0.8601

Compare expression of checked genes

Potri.003G194500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.