Plant FIBer expression Database

Potri.003G195450 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G36150 44 / 2e-06 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT5G45250 39 / 0.0002 RPS4 RESISTANT TO P. SYRINGAE 4, Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT5G17680 38 / 0.0005 disease resistance protein (TIR-NBS-LRR class), putative (.1)
AT1G27170 37 / 0.0009 transmembrane receptors;ATP binding (.1.2)
AT1G56510 37 / 0.001 ADR2, WRR4 WHITE RUST RESISTANCE 4, ACTIVATED DISEASE RESISTANCE 2, Disease resistance protein (TIR-NBS-LRR class) (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G012000
[exp]
48 / 1e-07 AT3G14470 367 / 7e-109 NB-ARC domain-containing disease resistance protein (.1)
Potri.017G127200
[exp]
44 / 2e-06 AT3G14470 404 / 4e-123 NB-ARC domain-containing disease resistance protein (.1)
Potri.017G133666
[exp]
43 / 5e-06 AT3G14470 416 / 7e-129 NB-ARC domain-containing disease resistance protein (.1)
Potri.017G138100
[exp]
43 / 7e-06 AT3G14470 397 / 4e-121 NB-ARC domain-containing disease resistance protein (.1)
Potri.017G121500
[exp]
42 / 2e-05 AT3G14470 483 / 9e-153 NB-ARC domain-containing disease resistance protein (.1)
Potri.001G429660
[exp]
41 / 2e-05 AT4G27220 227 / 6e-61 NB-ARC domain-containing disease resistance protein (.1)
Potri.018G145580
[exp]
40 / 5e-05 AT3G44480 81 / 2e-16 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1)
Potri.017G137700
[exp]
40 / 5e-05 AT3G14470 437 / 7e-136 NB-ARC domain-containing disease resistance protein (.1)
Potri.017G121700
[exp]
40 / 6e-05 AT3G14470 461 / 2e-144 NB-ARC domain-containing disease resistance protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020525
[exp]
39 / 0.0003 AT4G16950 66 / 2e-11 RECOGNITION OF PERONOSPORA PARASITICA 5, Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Lus10029628
[exp]
39 / 0.0003 AT1G27180 462 / 1e-138 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10007813
[exp]
38 / 0.0004 AT5G36930 368 / 1e-107 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
PFAM info
Representative CDS sequence
>Potri.003G195450.1 pacid=42785012 polypeptide=Potri.003G195450.1.p locus=Potri.003G195450 ID=Potri.003G195450.1.v4.1 annot-version=v4.1
ATGGATGGCAGAAGGTCTTGTCAGGCAACCGAGGAGGCAGAAGAAAATGGAAGAAAAATGGAAGATTTAGCCATTGGTGGTTGTGGTGACATCACCACGT
TGTCCAACCAAGCTGGATTTCAGCACCTGAGTTCTCTTCAAAAGTTGCAGATATATGGTTGTTCAGTATTATTAGAGAATTTACCTCACGAGCTGCACAA
ACCATCATCTCTGACCTTCCTGGAATTTGAGGGGTGTCCAAGTCTATATGGGATTGCCAACTATGCTTACACCTATCACTATTGA
AA sequence
>Potri.003G195450.1 pacid=42785012 polypeptide=Potri.003G195450.1.p locus=Potri.003G195450 ID=Potri.003G195450.1.v4.1 annot-version=v4.1
MDGRRSCQATEEAEENGRKMEDLAIGGCGDITTLSNQAGFQHLSSLQKLQIYGCSVLLENLPHELHKPSSLTFLEFEGCPSLYGIANYAYTYHY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G36150 Disease resistance protein (TI... Potri.003G195450
[exp]
0 1
AT5G42200 RING/U-box superfamily protein... Potri.005G244500
[exp]
9.53 0.7153
AT4G39720 VQ motif-containing protein (.... Potri.001G158800
[exp]
17.20 0.7335
AT1G17180 ATGSTU25 glutathione S-transferase TAU ... Potri.019G130433
[exp]
21.07 0.7226
Potri.018G074050
[exp]
27.34 0.6799
AT5G04760 MYB Duplicated homeodomain-like su... Potri.010G240800
[exp]
27.71 0.7271
AT2G38905 Low temperature and salt respo... Potri.010G217200
[exp]
28.24 0.7168
AT4G17030 ATHEXPBETA3.1, ... expansin-like B1 (.1) Potri.003G083200
[exp]
30.49 0.7172 PtrEXLB1,EXLB1.1
Potri.014G025451
[exp]
30.98 0.7098
AT4G33467 unknown protein Potri.007G109200
[exp]
32.40 0.7112
AT1G29500 SAUR-like auxin-responsive pro... Potri.002G064150
[exp]
33.49 0.6630

Potri.003G195450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.