Potri.003G203701 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.003G203701.1 pacid=42786665 polypeptide=Potri.003G203701.1.p locus=Potri.003G203701 ID=Potri.003G203701.1.v4.1 annot-version=v4.1
ATGTTGGCTCTGCGGGATGAAAGATGGGTTGCAGAGAAAAGGGACCAATGGAATTGCATTAAGCACAACACTCTGATCACTGTTTCGTGCTGCTATATGG
CATCGTGTCATTGGTGTGTACTGATTGCTGTAAAAGTGGATTAA
AA sequence
>Potri.003G203701.1 pacid=42786665 polypeptide=Potri.003G203701.1.p locus=Potri.003G203701 ID=Potri.003G203701.1.v4.1 annot-version=v4.1
MLALRDERWVAEKRDQWNCIKHNTLITVSCCYMASCHWCVLIAVKVD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.003G203701 0 1
AT1G54210 ATATG12, APG12,... AUTOPHAGY 12 A, AUTOPHAGY 12, ... Potri.003G064300 1.00 0.7454
AT3G18210 2-oxoglutarate (2OG) and Fe(II... Potri.008G125800 6.32 0.6090
AT4G10270 Wound-responsive family protei... Potri.019G116866 7.61 0.7179
AT4G10270 Wound-responsive family protei... Potri.019G117200 9.94 0.7004
Potri.001G194250 10.72 0.6750
AT3G02550 AS2 LBD41 LOB domain-containing protein ... Potri.004G100100 18.24 0.6462 Pt-LBD41.1
AT4G10270 Wound-responsive family protei... Potri.019G117301 18.33 0.6615
Potri.005G030901 18.73 0.6290
Potri.016G130201 20.39 0.6206
AT4G10270 Wound-responsive family protei... Potri.019G117201 26.98 0.6272

Potri.003G203701 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.