Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G63440 236 / 1e-72 HMA5 heavy metal atpase 5 (.1) AT5G44790 215 / 4e-65 HMA7, RAN1 copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting ATPase (RAN1) (.1) AT5G21930 124 / 5e-33 ATHMA8, HMA8, PAA2 ARABIDOPSIS HEAVY METAL ATPASE 8, P-type ATPase of Arabidopsis 2 (.1.2.3) AT4G33520 112 / 8e-29 AtHMAC6, HMA6, PAA1 Arabidopsis thaliana heavy metal ATPase 6, P-type ATP-ase 1 (.1.2.3) AT4G30110 76 / 5e-16 ATHMA2, HMA2 ARABIDOPSIS HEAVY METAL ATPASE 2, heavy metal atpase 2 (.1) AT2G19110 75 / 6e-16 ATHMA4, HMA4 ARABIDOPSIS HEAVY METAL ATPASE 4, heavy metal atpase 4 (.1) AT1G07670 72 / 8e-15 ATECA4 endomembrane-type CA-ATPase 4 (.1) AT1G07810 72 / 9e-15 ATECA1, ACA3, ECA1 ER-type Ca2+-ATPase 1, ARABIDOPSIS THALIANA ER-TYPE CA2+-ATPASE 1, ER-type Ca2+-ATPase 1 (.1) AT3G57330 69 / 1e-13 ACA11 autoinhibited Ca2+-ATPase 11, autoinhibited Ca2+-ATPase 11 (.1) AT2G41560 68 / 1e-13 ACA4 "autoinhibited Ca\(2+\)-ATPase, isoform 4", autoinhibited Ca(2+)-ATPase, isoform 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G019100 [exp] 275 / 2e-87 AT1G63440 1043 / 0.0 heavy metal atpase 5 (.1) Potri.003G125600 [exp] 221 / 4e-67 AT1G63440 1527 / 0.0 heavy metal atpase 5 (.1) Potri.003G125700 [exp] 220 / 7e-67 AT1G63440 1395 / 0.0 heavy metal atpase 5 (.1) Potri.001G105800 [exp] 219 / 2e-66 AT1G63440 1538 / 0.0 heavy metal atpase 5 (.1) Potri.003G075700 [exp] 210 / 2e-63 AT5G44790 1526 / 0.0 copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting ATPase (RAN1) (.1) Potri.001G158900 [exp] 206 / 5e-62 AT5G44790 1465 / 0.0 copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting ATPase (RAN1) (.1) Potri.018G047800 [exp] 124 / 4e-33 AT5G21930 1193 / 0.0 ARABIDOPSIS HEAVY METAL ATPASE 8, P-type ATPase of Arabidopsis 2 (.1.2.3) Potri.003G024000 [exp] 115 / 4e-30 AT4G33520 1078 / 0.0 Arabidopsis thaliana heavy metal ATPase 6, P-type ATP-ase 1 (.1.2.3) Potri.001G205400 [exp] 103 / 1e-25 AT4G33520 1066 / 0.0 Arabidopsis thaliana heavy metal ATPase 6, P-type ATP-ase 1 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031840 [exp] 256 / 2e-80 AT5G44790 573 / 0.0 copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting ATPase (RAN1) (.1) Lus10031273 [exp] 256 / 5e-80 AT1G63440 1040 / 0.0 heavy metal atpase 5 (.1) Lus10008309 [exp] 217 / 1e-65 AT1G63440 1491 / 0.0 heavy metal atpase 5 (.1) Lus10038364 [exp] 209 / 1e-62 AT5G44790 1441 / 0.0 copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting ATPase (RAN1) (.1) Lus10036225 [exp] 192 / 8e-57 AT5G44790 1402 / 0.0 copper-exporting ATPase / responsive-to-antagonist 1 / copper-transporting ATPase (RAN1) (.1) Lus10038070 [exp] 130 / 4e-35 AT5G21930 1146 / 0.0 ARABIDOPSIS HEAVY METAL ATPASE 8, P-type ATPase of Arabidopsis 2 (.1.2.3) Lus10009789 [exp] 125 / 4e-34 AT5G21930 447 / 1e-149 ARABIDOPSIS HEAVY METAL ATPASE 8, P-type ATPase of Arabidopsis 2 (.1.2.3) Lus10023777 [exp] 105 / 3e-26 AT4G33520 1180 / 0.0 Arabidopsis thaliana heavy metal ATPase 6, P-type ATP-ase 1 (.1.2.3) Lus10025467 [exp] 80 / 2e-17 AT4G30110 1073 / 0.0 ARABIDOPSIS HEAVY METAL ATPASE 2, heavy metal atpase 2 (.1) Lus10006955 [exp] 79 / 2e-17 AT2G19110 1072 / 0.0 ARABIDOPSIS HEAVY METAL ATPASE 4, heavy metal atpase 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0137 [poplar] [flax] HAD PF00702 [poplar] [flax] Hydrolase haloacid dehalogenase-like hydrolase
Representative CDS sequence Show only first row Show all	>Potri.003G204801.3 pacid=42787450 polypeptide=Potri.003G204801.3.p locus=Potri.003G204801 ID=Potri.003G204801.3.v4.1 annot-version=v4.1 ATGAGACCAGAAGCTCAGCTTGCTGCGTCTTTTCTCCGCTCACTGGGCATCTCAAGCATCATGACCAAAGGTGACAACTGGGCTGCAGCCACAGCCATTG CGAAGGAGGTTGGAATTGAGGATGTGTATGCCGAAATAGATCCCGTCGGAAAAGCTGCAAAGATCAAAGAGTTACAGATGAAAGGGATGAACGTTGCAAT GGTCGGAGACGGAATAAATGACTCGCCAGCCCTGCTTGTAGCTGATGTTGGGATGGAAATTGGTGCTGGGACAGATGTGGCTATAGAAGCAGCTGATATA GCTCTCATCAGAAGCAACTTGGAAGATGTAGTTTCAGCCATTGATCTATCCCGAAAGACCATCTCCCGAATTAGGATTAACTATTTCTGGGCACTTGGCT ACAACAGGATTAGCTTGCCTATTGCTGCTGGCATTCTGTACCCTTTCACTGGAATTCGGTTACCTCCTTGGCTTGCTGGTGCTTGCATGGCTGCTTCATC TCTTAATTTAGAAATTATGGGTTTTTTTTATAAATATTGGAGATTAAGCCTGTAG
AA sequence Show only first row Show all	>Potri.003G204801.3 pacid=42787450 polypeptide=Potri.003G204801.3.p locus=Potri.003G204801 ID=Potri.003G204801.3.v4.1 annot-version=v4.1 MRPEAQLAASFLRSLGISSIMTKGDNWAAATAIAKEVGIEDVYAEIDPVGKAAKIKELQMKGMNVAMVGDGINDSPALLVADVGMEIGAGTDVAIEAADI ALIRSNLEDVVSAIDLSRKTISRIRINYFWALGYNRISLPIAAGILYPFTGIRLPPWLAGACMAASSLNLEIMGFFYKYWRLSL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G63440		HMA5	heavy metal atpase 5 (.1)		Potri.003G204801 [exp]	0	1
AT1G02460			Pectin lyase-like superfamily ...		Potri.005G005500 [exp]	1.73	0.8375
AT5G35110			unknown protein		Potri.018G113700 [exp]	3.16	0.8261
AT5G02230			Haloacid dehalogenase-like hyd...		Potri.006G086900 [exp]	6.00	0.8224
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Potri.003G083200 [exp]	8.71	0.8522	PtrEXLB1,EXLB1.1
AT2G24130			Leucine-rich receptor-like pro...		Potri.018G103400 [exp]	8.83	0.8424
AT3G06520			agenet domain-containing prote...		Potri.010G149301 [exp]	9.48	0.7674
AT5G19440			NAD(P)-binding Rossmann-fold s...		Potri.001G256400 [exp]	13.85	0.7321	CCRL5
AT2G38905			Low temperature and salt respo...		Potri.010G217200 [exp]	14.38	0.8169
AT2G38870			Serine protease inhibitor, pot...		Potri.002G042300 [exp]	14.96	0.8270
AT2G38870			Serine protease inhibitor, pot...		Potri.010G075200 [exp]	16.30	0.8222

Compare expression of checked genes

Potri.003G204801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.