Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G65360 128 / 6e-40 Histone superfamily protein (.1) AT5G10400 128 / 6e-40 Histone superfamily protein (.1) AT5G10390 128 / 6e-40 Histone superfamily protein (.1) AT3G27360 128 / 6e-40 Histone superfamily protein (.1) AT1G09200 128 / 6e-40 Histone superfamily protein (.1) AT4G40040 127 / 1e-39 Histone superfamily protein (.1.2) AT4G40030 127 / 1e-39 Histone superfamily protein (.1.2.3) AT5G10980 127 / 1e-39 Histone superfamily protein (.1) AT1G75600 127 / 2e-39 Histone superfamily protein (.1) AT5G65350 125 / 8e-39 HTR11 histone 3 11 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G233900 [exp] 129 / 5e-40 AT5G65360 271 / 1e-95 Histone superfamily protein (.1) Potri.014G096900 [exp] 128 / 6e-40 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.002G028800 [exp] 128 / 6e-40 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.003G210100 [exp] 128 / 6e-40 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.003G207852 [exp] 128 / 6e-40 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.003G207700 [exp] 128 / 6e-40 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.001G016700 [exp] 128 / 6e-40 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.001G016900 [exp] 128 / 6e-40 AT5G65360 235 / 3e-81 Histone superfamily protein (.1) Potri.007G096700 [exp] 127 / 1e-39 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031822 [exp] 129 / 6e-40 AT5G10400 271 / 1e-95 Histone superfamily protein (.1) Lus10005271 [exp] 129 / 6e-40 AT1G09200 271 / 1e-95 Histone superfamily protein (.1) Lus10005270 [exp] 129 / 6e-40 AT1G09200 271 / 1e-95 Histone superfamily protein (.1) Lus10031250 [exp] 129 / 6e-40 AT1G09200 271 / 1e-95 Histone superfamily protein (.1) Lus10025439 [exp] 129 / 6e-40 AT5G65360 271 / 1e-95 Histone superfamily protein (.1) Lus10012744 [exp] 128 / 1e-39 AT5G65360 271 / 2e-95 Histone superfamily protein (.1) Lus10000284 [exp] 127 / 1e-39 AT4G40030 229 / 3e-79 Histone superfamily protein (.1.2.3) Lus10012757 [exp] 127 / 1e-39 AT4G40030 229 / 3e-79 Histone superfamily protein (.1.2.3) Lus10031821 [exp] 129 / 2e-39 AT3G27360 273 / 3e-95 Histone superfamily protein (.1) Lus10013948 [exp] 128 / 5e-39 AT3G27360 272 / 7e-95 Histone superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [poplar] [flax] Histone PF00125 [poplar] [flax] Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence Show only first row Show all	>Potri.003G208800.1 pacid=42786265 polypeptide=Potri.003G208800.1.p locus=Potri.003G208800 ID=Potri.003G208800.1.v4.1 annot-version=v4.1 ATGACACGAATCACAGATTTCAAGAAGAGCACTGAGCTGTTGATAAGGAAGCTTCCATTTCAAAGGCTGGTGAGGGAGATAGCCCAAGATTTCAAGACGG ATTTGAGGTTCCAAAGCAGCGCAGTGGCTGCCCTTCAGGAGGCGGCAGAGGCATATCTTGTAGGGTTGTTTGAGGATACCAACTTGTGTGCTATTCATGC TAAGAGGGTAACTATTATGCCTAAGGATATCCAATTGGCCCGAAGGATTAGAGGAGAGAGGGCTTAA
AA sequence Show only first row Show all	>Potri.003G208800.1 pacid=42786265 polypeptide=Potri.003G208800.1.p locus=Potri.003G208800 ID=Potri.003G208800.1.v4.1 annot-version=v4.1 MTRITDFKKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G65360			Histone superfamily protein (....		Potri.003G208800 [exp]	0	1
					Potri.013G111632 [exp]	3.46	0.9349
AT3G23750			Leucine-rich repeat protein ki...		Potri.005G049200 [exp]	8.48	0.9178
AT1G04880	ARID		HMG (high mobility group) box ...		Potri.001G315200 [exp]	9.69	0.8708
AT4G21530		APC4	anaphase promoting complex 4, ...		Potri.004G034900 [exp]	14.35	0.8696
AT1G07530	GRAS	SCL14, ATGRAS2	GRAS \(GAI, RGA, SCR\) 2, ARAB...		Potri.010G202300 [exp]	16.15	0.9260
AT5G52960			unknown protein		Potri.016G123100 [exp]	21.90	0.9229
AT5G14090			unknown protein		Potri.001G059100 [exp]	37.41	0.8542
AT4G11650		ATOSM34	osmotin 34 (.1)		Potri.018G096070 [exp]	41.43	0.9032
					Potri.013G111566 [exp]	48.98	0.8936
AT1G58470		XF41, ATRBP1	RNA-binding protein 1 (.1)		Potri.014G012700 [exp]	53.24	0.8810

Compare expression of checked genes

Potri.003G208800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.