Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06150 50 / 8e-08 bHLH bHLH089, EMB1444 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) AT2G39620 43 / 2e-05 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G03580 42 / 6e-05 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G46790 40 / 0.0002 CRR2 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G19191 40 / 0.0002 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G42920 39 / 0.0004 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT3G28660 38 / 0.001 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G18970 38 / 0.001 MEF20 mitochondrial editing factor 20 (.1) AT5G27110 0 / 1 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G050200 [exp] 49 / 1e-07 AT4G37380 817 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G043400 [exp] 47 / 7e-07 AT2G33760 775 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G111300 [exp] 47 / 7e-07 AT3G02330 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.001G322100 [exp] 47 / 1e-06 AT3G26782 897 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.012G108000 [exp] 45 / 2e-06 AT2G34400 640 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.011G052300 [exp] 44 / 1e-05 AT2G33760 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G205900 [exp] 43 / 2e-05 AT2G17210 737 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.008G052200 [exp] 43 / 2e-05 AT2G39620 816 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G041501 [exp] 42 / 2e-05 AT2G34400 251 / 1e-79 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036029 [exp] 85 / 5e-20 AT5G27110 577 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10009702 [exp] 80 / 3e-18 AT5G27110 409 / 1e-134 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10004987 [exp] 47 / 1e-06 AT3G46790 715 / 0.0 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10008825 [exp] 43 / 3e-05 AT1G06150 614 / 0.0 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) Lus10039974 [exp] 42 / 4e-05 AT1G06150 612 / 0.0 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) Lus10039117 [exp] 42 / 7e-05 AT3G24000 740 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10010320 [exp] 41 / 0.0001 AT2G34400 658 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Lus10017583 [exp] 41 / 0.0001 AT5G66520 481 / 2e-163 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10022702 [exp] 40 / 0.0004 AT3G11460 641 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10035815 [exp] 39 / 0.0004 AT4G30700 1026 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.003G210301.1 pacid=42786549 polypeptide=Potri.003G210301.1.p locus=Potri.003G210301 ID=Potri.003G210301.1.v4.1 annot-version=v4.1 ATGTTCATCCTCCTAAAACGCTTCAAGCATTCTCTGCTATCACCTTTCAATCCATACCCTGCAGTCAAAGAATACCAGGCAACCACAGTTTTTCTTAGCA GCTGCTCAGAAACCACTTCAGCCATCTCCAAGCAACCACATGTCACATACATATCCACAAGTGCAGAGCCAACAAAAAACACAAACCCTTTTCCCACCAT TTCCCTATGCATCCATTTTCCTCTTTTCAAATCCAAAAGCCCTGCACGCGAAGCAATAATAGCAGTCAATGTCACTGAGTTCGGCTCCAACCCATATTCC CTTGTCAGCTTTCCCATCATGATAATTACAAGAAATAACTGTATTCCAACTTTCCACATCTCTCTCAGGCATTTCAGCTTCCCAAAAAGAATTGCACTTC GCATATAA
AA sequence Show only first row Show all	>Potri.003G210301.1 pacid=42786549 polypeptide=Potri.003G210301.1.p locus=Potri.003G210301 ID=Potri.003G210301.1.v4.1 annot-version=v4.1 MFILLKRFKHSLLSPFNPYPAVKEYQATTVFLSSCSETTSAISKQPHVTYISTSAEPTKNTNPFPTISLCIHFPLFKSKSPAREAIIAVNVTEFGSNPYS LVSFPIMIITRNNCIPTFHISLRHFSFPKRIALRI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G27110			Tetratricopeptide repeat (TPR)...		Potri.003G210301 [exp]	0	1
AT3G02600		ATLPP3, LPP3	lipid phosphate phosphatase 3 ...		Potri.004G095400 [exp]	23.91	0.6487	LPP3.2
AT3G48080			alpha/beta-Hydrolases superfam...		Potri.012G074600 [exp]	35.77	0.6342	EDS1.1
AT5G19875			unknown protein		Potri.003G216100 [exp]	54.22	0.5875
AT2G16910	bHLH	AMS, bHLH021	ABORTED MICROSPORES, basic hel...		Potri.010G041500 [exp]	128.60	0.5174
AT2G15960			unknown protein		Potri.009G109300 [exp]	134.31	0.5327

Compare expression of checked genes

Potri.003G210301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.