Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60900 159 / 6e-46 RLK1 receptor-like protein kinase 1 (.1) AT1G34300 110 / 9e-29 lectin protein kinase family protein (.1) AT4G00340 105 / 8e-27 RLK4 receptor-like protein kinase 4 (.1) AT4G32300 104 / 1e-26 SD2-5 S-domain-2 5 (.1) AT5G24080 103 / 2e-26 Protein kinase superfamily protein (.1) AT2G19130 97 / 6e-24 S-locus lectin protein kinase family protein (.1) AT1G34210 96 / 8e-24 ATSERK2, SERK2 somatic embryogenesis receptor-like kinase 2 (.1) AT1G71830 95 / 2e-23 ATSERK1, SERK1 somatic embryogenesis receptor-like kinase 1 (.1) AT1G60800 95 / 3e-23 NIK3 NSP-interacting kinase 3 (.1) AT4G33430 94 / 8e-23 SERK3, RKS10, ELG, BAK1, ATSERK3, ATBAK1 RECEPTOR KINASES LIKE SERK 10, ELONGATED, SOMATIC EMBRYOGENESIS RECEPTOR-LIKE KINASE 3, BRI1-associated receptor kinase (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T085100 [exp] 244 / 3e-77 AT5G60900 554 / 0.0 receptor-like protein kinase 1 (.1) Potri.003G211866 [exp] 227 / 2e-74 AT5G60900 346 / 4e-113 receptor-like protein kinase 1 (.1) Potri.T085000 [exp] 235 / 8e-74 AT5G60900 559 / 0.0 receptor-like protein kinase 1 (.1) Potri.003G211700 [exp] 227 / 7e-71 AT5G60900 527 / 5e-177 receptor-like protein kinase 1 (.1) Potri.T084800 [exp] 227 / 8e-71 AT5G60900 485 / 3e-161 receptor-like protein kinase 1 (.1) Potri.T084900 [exp] 226 / 3e-70 AT5G60900 548 / 0.0 receptor-like protein kinase 1 (.1) Potri.003G211366 [exp] 222 / 6e-69 AT5G60900 568 / 0.0 receptor-like protein kinase 1 (.1) Potri.T085150 [exp] 219 / 5e-68 AT5G60900 554 / 0.0 receptor-like protein kinase 1 (.1) Potri.003G211800 [exp] 211 / 8e-65 AT5G60900 550 / 0.0 receptor-like protein kinase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024195 [exp] 189 / 1e-56 AT5G60900 367 / 3e-114 receptor-like protein kinase 1 (.1) Lus10018251 [exp] 174 / 5e-56 AT5G60900 213 / 2e-65 receptor-like protein kinase 1 (.1) Lus10030400 [exp] 174 / 5e-53 AT5G60900 356 / 1e-115 receptor-like protein kinase 1 (.1) Lus10031805 [exp] 175 / 1e-51 AT5G60900 530 / 5e-178 receptor-like protein kinase 1 (.1) Lus10031231 [exp] 175 / 1e-51 AT5G60900 536 / 2e-180 receptor-like protein kinase 1 (.1) Lus10031230 [exp] 162 / 6e-47 AT5G60900 388 / 4e-123 receptor-like protein kinase 1 (.1) Lus10031804 [exp] 146 / 1e-43 AT5G60900 234 / 2e-71 receptor-like protein kinase 1 (.1) Lus10004365 [exp] 149 / 2e-42 AT5G60900 545 / 0.0 receptor-like protein kinase 1 (.1) Lus10042940 [exp] 147 / 2e-41 AT5G60900 381 / 1e-120 receptor-like protein kinase 1 (.1) Lus10032438 [exp] 139 / 5e-41 AT5G60900 285 / 2e-90 receptor-like protein kinase 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF00069 [poplar] [flax] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Potri.003G211532.1 pacid=42785115 polypeptide=Potri.003G211532.1.p locus=Potri.003G211532 ID=Potri.003G211532.1.v4.1 annot-version=v4.1 ATGATTTCAGATTTCGGACTAGCCAAGCTGTTGAAGACGGACCAAACCAAAACAACGACAGCAATCAGGGGGACGAAAGGGTATGTAGCTCCTGAATGGT TCAAGAACCTGCCTGTCACAACCAAAGTAGATACCTACAGCTTTGGCATTCTCTTGCTGGAGCTAGTTTGCTGCAGAAAGAACTTTGAGATTAATGCAAT GCAAGAAGATCAGATAGTTCTTGCAGACTGGGCATGTGATTGCCTTAAAGAAGGAAAGTTGAACCTTTTAGTAGAAGAAGATGAAGAGGCAATGGAAGAC ATGAAAAGGGTAGAGAGGTTTGTGATGGTTGCAATTTGGTGCATTCAGGAAGATCCATCTTTAAGACCTGGAATGAAGAAAGTTGTGCAAATGTTAGAAG GAAGTGTTCAAGTCTCTGTTCCTCCTGATCCTTCATCATTTATCAGCACAATCTAA
AA sequence Show only first row Show all	>Potri.003G211532.1 pacid=42785115 polypeptide=Potri.003G211532.1.p locus=Potri.003G211532 ID=Potri.003G211532.1.v4.1 annot-version=v4.1 MISDFGLAKLLKTDQTKTTTAIRGTKGYVAPEWFKNLPVTTKVDTYSFGILLLELVCCRKNFEINAMQEDQIVLADWACDCLKEGKLNLLVEEDEEAMED MKRVERFVMVAIWCIQEDPSLRPGMKKVVQMLEGSVQVSVPPDPSSFISTI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G60900		RLK1	receptor-like protein kinase 1...		Potri.003G211532 [exp]	0	1
AT1G74300			alpha/beta-Hydrolases superfam...		Potri.008G021301 [exp]	18.27	0.6534
AT3G17980		AtC2	Arabidopsis thaliana C2 domain...		Potri.017G125500 [exp]	20.78	0.7046
AT5G49525			unknown protein		Potri.008G102400 [exp]	41.10	0.6615
AT5G25260			SPFH/Band 7/PHB domain-contain...		Potri.006G258900 [exp]	42.00	0.7360
AT1G49390			2-oxoglutarate (2OG) and Fe(II...		Potri.018G121750 [exp]	74.89	0.7091
AT3G62270			HCO3- transporter family (.1)		Potri.015G077600 [exp]	76.21	0.7135
AT5G10530			Concanavalin A-like lectin pro...		Potri.007G004300 [exp]	77.57	0.7060
AT5G57850			D-aminoacid aminotransferase-l...		Potri.018G039000 [exp]	83.66	0.7017
AT2G15490		UGT73B4	UDP-glycosyltransferase 73B4 (...		Potri.018G009000 [exp]	110.36	0.6993
AT4G18450	AP2_ERF		Integrase-type DNA-binding sup...		Potri.004G051800 [exp]	126.12	0.6540

Compare expression of checked genes

Potri.003G211532 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.