PRX1.10 (Potri.003G214500) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol PRX1.10
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G19890 422 / 3e-149 Peroxidase superfamily protein (.1)
AT5G06720 372 / 2e-129 ATPA2 peroxidase 2 (.1)
AT5G06730 369 / 7e-128 Peroxidase superfamily protein (.1)
AT2G18140 328 / 5e-112 Peroxidase superfamily protein (.1)
AT4G36430 327 / 1e-111 Peroxidase superfamily protein (.1)
AT2G18150 325 / 1e-110 Peroxidase superfamily protein (.1)
AT5G19880 311 / 1e-105 Peroxidase superfamily protein (.1)
AT5G05340 308 / 3e-104 Peroxidase superfamily protein (.1)
AT5G66390 308 / 7e-104 Peroxidase superfamily protein (.1)
AT5G58400 307 / 7e-104 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G058200 364 / 3e-126 AT5G06720 428 / 2e-151 peroxidase 2 (.1)
Potri.003G214800 351 / 1e-120 AT5G06720 451 / 5e-160 peroxidase 2 (.1)
Potri.003G214700 347 / 3e-119 AT5G06720 459 / 5e-163 peroxidase 2 (.1)
Potri.001G011200 332 / 2e-113 AT3G49120 381 / 2e-132 PEROXIDASE 34, ARABIDOPSIS THALIANA PEROXIDASE CB, peroxidase CB (.1)
Potri.001G012901 328 / 7e-112 AT5G06730 387 / 1e-134 Peroxidase superfamily protein (.1)
Potri.001G011300 324 / 3e-110 AT3G49120 410 / 8e-144 PEROXIDASE 34, ARABIDOPSIS THALIANA PEROXIDASE CB, peroxidase CB (.1)
Potri.005G118700 321 / 4e-109 AT5G66390 504 / 0.0 Peroxidase superfamily protein (.1)
Potri.013G154400 320 / 6e-109 AT5G05340 363 / 3e-126 Peroxidase superfamily protein (.1)
Potri.005G135300 320 / 9e-109 AT1G49570 408 / 3e-143 Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025535 447 / 4e-157 AT5G19890 406 / 9e-141 Peroxidase superfamily protein (.1)
Lus10026748 443 / 4e-157 AT5G19890 402 / 6e-141 Peroxidase superfamily protein (.1)
Lus10004163 351 / 5e-121 AT5G06720 446 / 1e-158 peroxidase 2 (.1)
Lus10008168 343 / 1e-117 AT5G06720 393 / 5e-137 peroxidase 2 (.1)
Lus10027989 328 / 1e-111 AT5G06720 400 / 1e-139 peroxidase 2 (.1)
Lus10027984 326 / 1e-110 AT5G06730 402 / 2e-140 Peroxidase superfamily protein (.1)
Lus10008173 325 / 2e-110 AT5G06730 407 / 3e-142 Peroxidase superfamily protein (.1)
Lus10009901 324 / 2e-110 AT1G49570 384 / 5e-134 Peroxidase superfamily protein (.1)
Lus10041784 321 / 3e-109 AT5G66390 519 / 0.0 Peroxidase superfamily protein (.1)
Lus10008167 321 / 2e-108 AT5G06720 399 / 3e-139 peroxidase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.003G214500.1 pacid=42787439 polypeptide=Potri.003G214500.1.p locus=Potri.003G214500 ID=Potri.003G214500.1.v4.1 annot-version=v4.1
ATGAAGAGGTCGAGCTGCTATAACGGTTATTCGTTGTTTCTGACAATATTGATGTTATGTGTAGTTGCCAGGTCCCAACTGACTACCGATTTCTATTCGA
CAACATGTCCTAACCTTCTCCAAATTGTCCGTAGAGAAGTTCAGAAAGCTATCAAGTTCGAAACACGTATGGCAGCCTCTTTGATTCGGCTTCATTTTCA
TGACTGCTTTGTCAATGGTTGTGATGCATCAGTTCTGCTGGATGGAAATGATGGTGAGAAGTTTGCTTTGCCTAACATAAACTCGGCAAGGGGATTTGAA
GTTGTGGATGCAATAAAAACTGCTGTGGAAAGTCAATGTAGTGGCGTTGTATCTTGTGCTGATATACTAACCATAGCTGCCCGAGATTCGGTCCTCCTTA
GTGGGGGGAAATCATGGAGAGTTCTGCTCGGAAGAAGAGATGGACTAGTGGCTAACCAGACTGGAGCAAATGCTAAACTTCCTTCCCCGTTTGAAGATGT
GGATACGATCATCAACAAGTTTGCTGCAGTAGGATTAAATATCATAGACGTAGTCGCCTTATCCGGTGCTCACACAATTGGACAAGCAAGATGTGCCACC
TTCAACAACAGATTGTTCAACTTCTCGGGAACCGGTGCTCCGGACAGTACAATGGAATCAAGTATGGTGTCTGATCTGCAAAATCTATGTCCACTAACTG
ATGATGGCAACAAGACTACAGTTCTTGATCGGAACTCCACTGATCTATTTGACATCCACTATTTCCAGAACTTGCTAAACAATAAGGGTCTTCTCTCTTC
TGACCAAGAACTATTTTCAAGTACCAATTTGACAACCAAAGCTCTGGTTCAGACCTATAGCACTAATCAAAATCTTTTCTTAAATGACTTTGCTAATTCC
ATGATCAAAATGGGGAATATAAGCCCGCTAACAGGGTCTAGTGGAGAGATCAGGAAAAAATGTAGTGTGGTTAATTCGTGA
AA sequence
>Potri.003G214500.1 pacid=42787439 polypeptide=Potri.003G214500.1.p locus=Potri.003G214500 ID=Potri.003G214500.1.v4.1 annot-version=v4.1
MKRSSCYNGYSLFLTILMLCVVARSQLTTDFYSTTCPNLLQIVRREVQKAIKFETRMAASLIRLHFHDCFVNGCDASVLLDGNDGEKFALPNINSARGFE
VVDAIKTAVESQCSGVVSCADILTIAARDSVLLSGGKSWRVLLGRRDGLVANQTGANAKLPSPFEDVDTIINKFAAVGLNIIDVVALSGAHTIGQARCAT
FNNRLFNFSGTGAPDSTMESSMVSDLQNLCPLTDDGNKTTVLDRNSTDLFDIHYFQNLLNNKGLLSSDQELFSSTNLTTKALVQTYSTNQNLFLNDFANS
MIKMGNISPLTGSSGEIRKKCSVVNS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G19890 Peroxidase superfamily protein... Potri.003G214500 0 1 PRX1.10
Potri.013G070350 1.41 0.9780
AT1G52800 2-oxoglutarate (2OG) and Fe(II... Potri.001G176100 2.23 0.9858 2OGox3
AT1G16310 Cation efflux family protein (... Potri.010G172700 2.44 0.9715
AT3G52970 CYP76G1 "cytochrome P450, family 76, s... Potri.005G030100 3.87 0.9739 CYP76G5
AT2G28780 unknown protein Potri.009G028600 4.35 0.9495
AT2G39380 ATEXO70H2 exocyst subunit exo70 family p... Potri.008G048700 5.47 0.9661
AT2G41705 camphor resistance CrcB family... Potri.002G086800 6.00 0.9538
AT4G17340 TIP2;2, DELTA-T... tonoplast intrinsic protein 2;... Potri.001G157000 6.00 0.9699 TIP2.6
AT2G42250 CYP712A1 "cytochrome P450, family 712, ... Potri.006G057900 8.00 0.9740
AT5G53190 SWEET3, AtSWEET... Nodulin MtN3 family protein (.... Potri.015G021900 10.95 0.9612

Potri.003G214500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.