Potri.003G215300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G31945 67 / 2e-16 unknown protein
AT1G05575 52 / 3e-10 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G010600 118 / 1e-36 AT2G31945 62 / 2e-14 unknown protein
Potri.009G024300 79 / 5e-21 AT2G31945 84 / 8e-23 unknown protein
Potri.001G230900 72 / 4e-18 AT2G31945 79 / 1e-20 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039201 81 / 9e-22 AT2G31945 69 / 7e-17 unknown protein
Lus10013740 79 / 8e-21 AT2G31945 70 / 4e-17 unknown protein
PFAM info
Representative CDS sequence
>Potri.003G215300.1 pacid=42787421 polypeptide=Potri.003G215300.1.p locus=Potri.003G215300 ID=Potri.003G215300.1.v4.1 annot-version=v4.1
ATGGAGGTGCAGGAGGCATCATTAGCTGATTTCTTGATCAAGTTGGCCATGTTTGTGCTTGTACAAGTTTTGGTGTATCTAATACTTTCAAAGTCATCTA
ATGTCTTCTCCGAGAACAAGACAAGATCATTCAGCTTCAAACCTGCTCGTTCTCTTAGCATTCGCAGTTTCTTGGATGCTCTTTCTGACATCCCACTAGG
CAGCGGTGACCCATCACCATTATGA
AA sequence
>Potri.003G215300.1 pacid=42787421 polypeptide=Potri.003G215300.1.p locus=Potri.003G215300 ID=Potri.003G215300.1.v4.1 annot-version=v4.1
MEVQEASLADFLIKLAMFVLVQVLVYLILSKSSNVFSENKTRSFSFKPARSLSIRSFLDALSDIPLGSGDPSPL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G31945 unknown protein Potri.003G215300 0 1
AT1G19300 ATGATL1, GATL1,... PARVUS, GAOLAOZHUANGREN 1, GAL... Potri.002G132900 2.00 0.8572
AT1G73640 AtRABA6a RAB GTPase homolog A6A (.1) Potri.015G039700 2.00 0.8322
AT4G03270 CYCD6;1 Cyclin D6;1 (.1) Potri.011G040500 3.87 0.7970
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Potri.001G248700 6.63 0.7680
Potri.019G129820 8.48 0.8076
AT1G23160 Auxin-responsive GH3 family pr... Potri.014G136800 13.07 0.7411
AT1G47270 TUB AtTLP6 tubby like protein 6 (.1.2) Potri.005G228500 15.42 0.7503
Potri.019G129200 20.19 0.7267
AT2G17760 Eukaryotic aspartyl protease f... Potri.005G108700 21.56 0.7561
AT1G67070 PMI2, DIN9 PHOSPHOMANNOSE ISOMERASE 2, DA... Potri.004G099100 21.77 0.6642 DIN9.2

Potri.003G215300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.