Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G58170 226 / 9e-76 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G55210 225 / 2e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) AT3G13650 218 / 1e-72 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49040 211 / 1e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G65870 180 / 1e-57 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49030 185 / 7e-54 OVA2 ovule abortion 2, tRNA synthetase class I (I, L, M and V) family protein (.1), tRNA synthetase class I (I, L, M and V) family protein (.2), tRNA synthetase class I (I, L, M and V) family protein (.3) AT3G13662 169 / 1e-53 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT2G21100 169 / 3e-53 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13660 162 / 9e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42510 162 / 1e-50 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G216300 [exp] 337 / 2e-119 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.016G061000 [exp] 245 / 3e-83 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G009100 [exp] 241 / 1e-81 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216200 [exp] 236 / 1e-79 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.006G195300 [exp] 235 / 2e-79 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060900 [exp] 229 / 8e-77 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060700 [exp] 218 / 8e-73 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.009G131000 [exp] 192 / 2e-62 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060801 [exp] 189 / 2e-61 AT1G58170 164 / 5e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026176 [exp] 256 / 1e-87 AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10042488 [exp] 248 / 2e-84 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10029306 [exp] 223 / 2e-74 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10030483 [exp] 204 / 6e-67 AT1G65870 164 / 1e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10017231 [exp] 200 / 2e-65 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10021084 [exp] 178 / 1e-56 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034476 [exp] 166 / 7e-52 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10039561 [exp] 165 / 9e-52 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10016237 [exp] 162 / 2e-51 AT1G58170 149 / 6e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10016231 [exp] 158 / 4e-49 AT1G65870 149 / 8e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [poplar] [flax] AOC_barrel PF03018 [poplar] [flax] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Potri.003G216400.1 pacid=42786284 polypeptide=Potri.003G216400.1.p locus=Potri.003G216400 ID=Potri.003G216400.1.v4.1 annot-version=v4.1 ATGTACACTATTGATCATAGCCTCACAATAATGTCGACTAAGGCTAGAGTTTTCTCTGCTATAGTTTCTCACTCCATCCTCCTCACCCTCCTCTCTTCCT TTGTCACCGGAGAAAACCAAGATTTTGTCAGAAGCCTAGACCGCAAGCTTTATGGGTTGAAGAAAGAAAAGCTAACACATTTTCGTGTGTATTGGCATGA CATTTATAGTGCCCCCAACCCTACAGCCATGCCCATAGTGAGAGCACCTTCCAACACATCAGCAACTCTTTTCGGTTCTATAAGCATGATCGATGATCCA TTGACAGAAAAGCCAGAACTAAGCTCGAAATTGATAGGAAGAGCTCAAGGGTTTTATGGATCAGCAGGACAAGAAGAAACTGCCCTTTTGATGGCCATGA ACTTTGTTTTCCTTCAAGGCAAGTACAATGGTAGCACCATTAGCATACTAGGGAGGAACCATGTTTTTTCCAAGGTGAGAGAGATGCCGGTGATCGGAGG TAGTGGGCTTTTCCGGTTTGCCAGAGGATATGCTCAGGCCAGTACTCACAGTTTTGATCTAAAATCTGGTGATGCTGTCGTTGAGTATAATGTCTATGTA TTGCACTATTGA
AA sequence Show only first row Show all	>Potri.003G216400.1 pacid=42786284 polypeptide=Potri.003G216400.1.p locus=Potri.003G216400 ID=Potri.003G216400.1.v4.1 annot-version=v4.1 MYTIDHSLTIMSTKARVFSAIVSHSILLTLLSSFVTGENQDFVRSLDRKLYGLKKEKLTHFRVYWHDIYSAPNPTAMPIVRAPSNTSATLFGSISMIDDP LTEKPELSSKLIGRAQGFYGSAGQEETALLMAMNFVFLQGKYNGSTISILGRNHVFSKVREMPVIGGSGLFRFARGYAQASTHSFDLKSGDAVVEYNVYV LHY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G58170			Disease resistance-responsive ...		Potri.003G216400 [exp]	0	1
AT1G55210			Disease resistance-responsive ...		Potri.003G216300 [exp]	2.00	0.7144
AT5G02230			Haloacid dehalogenase-like hyd...		Potri.006G086900 [exp]	6.55	0.7255
AT5G59970			Histone superfamily protein (....		Potri.010G214000 [exp]	7.74	0.6281
AT5G16940			carbon-sulfur lyases (.1.2)		Potri.017G132000 [exp]	12.96	0.6551
AT4G11820		FKP1, EMB2778, ...	FLAKY POLLEN 1, hydroxymethylg...		Potri.003G120300 [exp]	30.28	0.6433
AT1G70780			unknown protein		Potri.008G131600 [exp]	42.84	0.6169
AT5G59970			Histone superfamily protein (....		Potri.010G213900 [exp]	44.45	0.5883	HFO913
AT1G27290			unknown protein		Potri.003G170300 [exp]	54.22	0.5324
AT5G35110			unknown protein		Potri.018G113700 [exp]	56.74	0.6065
AT1G68760		ATNUDX1, ATNUDT...	NUDIX HYDROLASE 1, ARABIDOPSIS...		Potri.008G114400 [exp]	68.11	0.5869

Compare expression of checked genes

Potri.003G216400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.