Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55260 149 / 3e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G44290 143 / 5e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G44300 141 / 2e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G58550 111 / 5e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G73890 61 / 1e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 59 / 4e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 56 / 1e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G09370 53 / 5e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G14815 51 / 3e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G13820 51 / 4e-08 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G008500 [exp] 281 / 1e-97 AT2G44290 155 / 6e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232000 [exp] 154 / 2e-47 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G195700 [exp] 139 / 6e-42 AT2G44290 145 / 6e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G053700 [exp] 58 / 1e-10 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.015G054000 [exp] 58 / 1e-10 AT1G73890 113 / 2e-31 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G172400 [exp] 56 / 8e-10 AT1G27950 145 / 5e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Potri.010G085400 [exp] 54 / 4e-09 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G210100 [exp] 49 / 2e-07 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.008G155100 [exp] 49 / 2e-07 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042449 [exp] 159 / 3e-49 AT1G55260 160 / 3e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10026220 [exp] 139 / 2e-40 AT2G44300 131 / 6e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10035975 [exp] 121 / 2e-32 AT2G17270 398 / 7e-137 phosphate transporter 3;3 (.1) Lus10017749 [exp] 96 / 1e-24 AT2G44290 115 / 3e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10033076 [exp] 92 / 4e-23 AT2G44290 114 / 6e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014681 [exp] 59 / 5e-11 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032488 [exp] 57 / 3e-10 AT1G73890 84 / 2e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10015779 [exp] 55 / 2e-09 AT1G27950 144 / 8e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1) Lus10042984 [exp] 54 / 3e-09 AT1G73890 81 / 3e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10037027 [exp] 52 / 2e-08 AT1G27950 147 / 3e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.003G217000.5 pacid=42785323 polypeptide=Potri.003G217000.5.p locus=Potri.003G217000 ID=Potri.003G217000.5.v4.1 annot-version=v4.1 ATGGGCTCAAAAAATGGCGTGACTACCTCAGCAATTTCATATATTTTGGTGCTGTTGATGCTAGTTGGTTCTGCAAAATCAGACTTTCAGCAAGACAGAG CAGAATGTGCAGACCAACTAGTGGGTTTGGCCACATGTCTTCCATATGTCAGTGATGATGCTAAAGCTCCTACCCTAGATTGTTGTAGTGGGCTTAAACA GGTGTTGGATAAGAGTAAGAAATGCCTTTGTGTCCTAATTAAAGATCGTGATAATCCCAATCTTGGTATCAAGTTCAATGTTAGTCTTGTTGCTAAACTT CCTAGCTTGTGCCATTCACCTGTTAATGTAACAGAATGCATCAATCTTCTGCACTTGCCTGCTAACTCACCAGACGCAAAGTTCTTTGAAGGATTTGCCA ACGTCACACAATCTGGAAGTATCGATACCCCAGTTGGCAGTGGGAGTTCAATTGGCAGCAACCCAAGTTCAGCTGCAGAGAAGAGTAGTGATGAGAGGCC AGCAAATAGATGGCTTGTAGCAGAGATCGTGTGTGGATCATTACTACTGGCTTTCACATCTGTTGGTTTCTGA
AA sequence Show only first row Show all	>Potri.003G217000.5 pacid=42785323 polypeptide=Potri.003G217000.5.p locus=Potri.003G217000 ID=Potri.003G217000.5.v4.1 annot-version=v4.1 MGSKNGVTTSAISYILVLLMLVGSAKSDFQQDRAECADQLVGLATCLPYVSDDAKAPTLDCCSGLKQVLDKSKKCLCVLIKDRDNPNLGIKFNVSLVAKL PSLCHSPVNVTECINLLHLPANSPDAKFFEGFANVTQSGSIDTPVGSGSSIGSNPSSAAEKSSDERPANRWLVAEIVCGSLLLAFTSVGF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G55260			Bifunctional inhibitor/lipid-t...		Potri.003G217000 [exp]	0	1
AT2G34430		LHCB1.4, LHB1B1	light-harvesting chlorophyll-p...		Potri.011G079500 [exp]	5.47	0.9677	Lhcb1-1,Pt-LHB1.2
ATCG01010		ATCG01010.1, ND...	NADH-Ubiquinone oxidoreductase...		Potri.011G084150 [exp]	5.74	0.9505
AT5G45820		PKS18, CIPK20, ...	SNF1-RELATED PROTEIN KINASE 3....		Potri.011G067500 [exp]	6.48	0.9677	Pt-CIPK20.1
AT1G30380		PSAK	photosystem I subunit K (.1)		Potri.018G027600 [exp]	17.88	0.9516	Pt-PSAK.1
					Potri.001G056750 [exp]	22.84	0.9374
AT2G06510		ATRPA70A, ATRPA...	ARABIDOPSIS THALIANA RPA70-KDA...		Potri.018G065300 [exp]	23.23	0.9508
AT3G02645			Plant protein of unknown funct...		Potri.003G205900 [exp]	24.49	0.9578
AT1G58684			Ribosomal protein S5 family pr...		Potri.001G256800 [exp]	25.37	0.9474
AT3G52720		CAH1, ATACA1, A...	A. THALIANA ALPHA CARBONIC ANH...		Potri.016G079600 [exp]	25.49	0.9398
AT2G30570		PSBW	photosystem II reaction center...		Potri.002G044300 [exp]	28.14	0.9407

Compare expression of checked genes

Potri.003G217000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.