Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G57510 35 / 0.001 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G008160 [exp] 102 / 2e-30 AT2G26110 45 / 7e-07 Protein of unknown function (DUF761) (.1) Potri.001G008080 [exp] 89 / 2e-25 AT2G26110 44 / 2e-06 Protein of unknown function (DUF761) (.1) Potri.003G217600 [exp] 55 / 9e-12 ND / Potri.001G171701 [exp] 39 / 3e-05 AT1G15385 53 / 7e-11 unknown protein Potri.011G087000 [exp] 37 / 0.0004 ND / Potri.003G062300 [exp] 35 / 0.0004 AT1G15385 58 / 8e-13 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014282 [exp] 37 / 0.0005 AT5G56980 84 / 1e-18 unknown protein Lus10025985 [exp] 36 / 0.0007 AT5G56980 82 / 4e-18 unknown protein Lus10004758 [exp] 36 / 0.0008 AT4G16790 72 / 5e-13 hydroxyproline-rich glycoprotein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05553 [poplar] [flax] DUF761 Cotton fibre expressed protein
Representative CDS sequence Show only first row Show all	>Potri.003G217500.1 pacid=42786241 polypeptide=Potri.003G217500.1.p locus=Potri.003G217500 ID=Potri.003G217500.1.v4.1 annot-version=v4.1 ATGGAAGATCATAAAGAAGTTGCTAAGCATGATAGTCTTGACATTGATGACAAGAAAACTGAGGAAAGGAGGGAAACAAGGCTGCAAAATCGGTTGATTA TGGAGGACTATAGGGAAGATATAAATGAAAAGGCTGATGCTTTCATTAAGAACTTCCGCGATCAACTTAAGATTCAGCGCGAAGATTCGCTTGAACGCTT CCACTAG
AA sequence Show only first row Show all	>Potri.003G217500.1 pacid=42786241 polypeptide=Potri.003G217500.1.p locus=Potri.003G217500 ID=Potri.003G217500.1.v4.1 annot-version=v4.1 MEDHKEVAKHDSLDIDDKKTEERRETRLQNRLIMEDYREDINEKADAFIKNFRDQLKIQREDSLERFH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
					Potri.003G217500 [exp]	0	1
AT4G33280	B3	REM16	AP2/B3-like transcriptional fa...		Potri.002G129900 [exp]	1.00	0.9697
AT4G02380		SAG21, ATLEA5	Arabidopsis thaliana late embr...		Potri.003G072000 [exp]	3.16	0.9568
AT3G26350			unknown protein		Potri.010G049000 [exp]	6.00	0.9559
AT4G05430			Carbohydrate-binding X8 domain...		Potri.007G111000 [exp]	7.74	0.9462
AT1G79915			Putative methyltransferase fam...		Potri.001G181200 [exp]	9.89	0.8757
AT1G08650		ATPPCK1, PPCK1	phosphoenolpyruvate carboxylas...		Potri.010G071400 [exp]	14.00	0.9577
					Potri.001G233550 [exp]	14.56	0.8657
AT5G14510			ARM repeat superfamily protein...		Potri.001G344200 [exp]	18.89	0.9184
AT3G61250	MYB	LMI2, ATMYB17	LATE MERISTEM IDENTITY2, myb d...		Potri.012G140700 [exp]	20.29	0.8682
AT3G47180			RING/U-box superfamily protein...		Potri.002G080900 [exp]	20.34	0.9017

Compare expression of checked genes

Potri.003G217500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.