Potri.003G218300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G30380 86 / 2e-22 EXLB2 Barwin-related endoglucanase (.1)
AT2G18660 69 / 1e-15 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
AT2G45110 53 / 6e-09 ATHEXPBETA1.1, ATEXPB4 expansin B4 (.1)
AT5G39310 53 / 7e-09 ATHEXPALPHA1.19, ATEXP24, ATEXPA24 EXPANSIN 24, expansin A24 (.1)
AT1G62980 52 / 9e-09 ATHEXPALPHA1.25, ATEXP18, ATEXPA18 EXPANSIN 18, expansin A18 (.1)
AT4G01630 52 / 2e-08 ATEXP17, ATHEXPALPHA1.13, ATEXPA17 EXPANSIN 17, expansin A17 (.1)
AT5G39280 51 / 3e-08 ATEXP23, ATHEXPALPHA1.17, ATEXPA23 EXPANSIN 23, expansin A23 (.1)
AT1G12560 50 / 5e-08 ATHEXPALPHA1.26, ATEXP7, ATEXPA7 expansin A7 (.1)
AT1G69530 50 / 5e-08 ATHEXPALPHA1.2, AT-EXP1, ATEXP1, ATEXPA1, EXP1 EXPANSIN 1, expansin A1 (.1.2.3.4.5)
AT5G02260 50 / 7e-08 ATHEXPALPHA1.10, ATEXP9, ATEXPA9 expansin A9 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G098200 131 / 3e-40 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.006G179300 112 / 1e-32 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.018G101600 111 / 3e-32 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.006G176300 96 / 2e-26 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
Potri.006G252200 84 / 9e-22 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1)
Potri.018G029100 84 / 1e-21 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1)
Potri.018G031901 80 / 8e-20 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
Potri.006G249500 75 / 4e-18 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
Potri.006G155000 64 / 8e-14 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042435 133 / 1e-40 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Lus10026232 115 / 2e-33 AT4G30380 90 / 2e-23 Barwin-related endoglucanase (.1)
Lus10019978 96 / 2e-26 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1)
Lus10031759 92 / 3e-24 AT2G18660 107 / 1e-30 plant natriuretic peptide A (.1)
Lus10020130 84 / 5e-21 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1)
Lus10026930 82 / 8e-20 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1)
Lus10026931 78 / 3e-18 AT4G30380 64 / 9e-13 Barwin-related endoglucanase (.1)
Lus10030078 74 / 2e-17 AT2G18660 84 / 3e-21 plant natriuretic peptide A (.1)
Lus10013118 72 / 6e-17 AT4G30380 67 / 5e-15 Barwin-related endoglucanase (.1)
Lus10026929 71 / 2e-16 AT2G18660 53 / 1e-09 plant natriuretic peptide A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Potri.003G218300.1 pacid=42785795 polypeptide=Potri.003G218300.1.p locus=Potri.003G218300 ID=Potri.003G218300.1.v4.1 annot-version=v4.1
ATGGCATCCGTCTTCAAGAATTTCATTGCCTCTTCTGTTATGACATTGTTGTGTTTCAGTTTGTGCTTTTATCCATTCGCATTGGCTCAAGATTCAGGAA
CTGCGACCTTCAACACACCCCCATACGTTCCTTCTAAATGCTATGGATATGAAGATCGAGGAGTGATGATTGCAGCAGCAAGTGAAGGGATTTTTAACAA
TGGGGAAGCTTGTGGGCTATATTACCAAGTAACTTGTGTTAGCGGGACAAATGAGGGCACTCCATTCCCTTGTTTGGATAATGGGTCAGTTGTTGTGATG
ATTACAGATCTTTGCCCTCCTGATTCTTGTAGGGGTACCATTGATTTGTCACAAGAAGCTTTTGCCTCCATTGCTGACCCCAATTCTGGCGTTATAAACA
TCTCTTACCAACAGATTTGA
AA sequence
>Potri.003G218300.1 pacid=42785795 polypeptide=Potri.003G218300.1.p locus=Potri.003G218300 ID=Potri.003G218300.1.v4.1 annot-version=v4.1
MASVFKNFIASSVMTLLCFSLCFYPFALAQDSGTATFNTPPYVPSKCYGYEDRGVMIAAASEGIFNNGEACGLYYQVTCVSGTNEGTPFPCLDNGSVVVM
ITDLCPPDSCRGTIDLSQEAFASIADPNSGVINISYQQI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G30380 EXLB2 Barwin-related endoglucanase (... Potri.003G218300 0 1
AT4G16447 unknown protein Potri.011G086300 3.46 0.9626
AT1G34065 SAMC2 S-adenosylmethionine carrier 2... Potri.002G063901 5.74 0.7423
AT1G09060 Zinc finger, RING-type;Transcr... Potri.005G026950 5.91 0.7995
AT1G22110 structural constituent of ribo... Potri.005G169900 6.70 0.7721
AT2G29620 unknown protein Potri.009G043000 7.21 0.7280
Potri.013G104501 7.34 0.8058
AT3G20190 Leucine-rich repeat protein ki... Potri.004G170274 16.43 0.6519
AT5G01680 ATCHX26 cation/H+ exchanger 26, ARABID... Potri.016G127800 16.49 0.6316 ATCHX27.1
AT4G27790 Calcium-binding EF hand family... Potri.015G010300 18.89 0.5660
AT4G22300 SOBER1 SUPPRESSOR OF AVRBST-ELICITED ... Potri.004G001701 76.34 0.5486

Potri.003G218300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.