Plant FIBer expression Database

Potri.003G220000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G004900
[exp]
92 / 2e-24 ND /
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.003G220000.1 pacid=42786444 polypeptide=Potri.003G220000.1.p locus=Potri.003G220000 ID=Potri.003G220000.1.v4.1 annot-version=v4.1
ATGCAAAAGCCAGAGAAAACGGGAATGCAGAAGCAAAAGAAGCGGGAAATTGACAGACGTTATCGACAGAAGAAGAAGAAAGCAGTGGTAGAAACCAAGA
TCAAACTGGCCATGACCATGATTGAAAATGAAAATTTAAAGTCCACTGTCCAAAAACTCGAGCAAGAAATCATCCAACTTACAAAGCAGCTGAATTCGAT
TGAACCAAGGCCAGATCAGACCACATATGATGAGCTGCAGCAAGAAATCAAATACCTGAGGGTTGAAAATGAAGTGACCAAGTGTCTATTGAAAGATACC
GACGCCAGTTACATCTCAAACATGATTAAGGTTCTAAAAGAAAATGAAGACATGAAAAGAACTATAGAACACTACGAGAGGCTCTCGTCGCATGCAGGGT
GCCTGAAAAAGCTTGAAACATGA
AA sequence
>Potri.003G220000.1 pacid=42786444 polypeptide=Potri.003G220000.1.p locus=Potri.003G220000 ID=Potri.003G220000.1.v4.1 annot-version=v4.1
MQKPEKTGMQKQKKREIDRRYRQKKKKAVVETKIKLAMTMIENENLKSTVQKLEQEIIQLTKQLNSIEPRPDQTTYDELQQEIKYLRVENEVTKCLLKDT
DASYISNMIKVLKENEDMKRTIEHYERLSSHAGCLKKLET

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.003G220000
[exp]
0 1
AT2G28190 CZSOD2, CSD2 copper/zinc superoxide dismuta... Potri.009G005100
[exp]
6.92 0.9099
AT2G34430 LHCB1.4, LHB1B1 light-harvesting chlorophyll-p... Potri.005G239300
[exp]
7.07 0.9304 LHB1.3,Lhcb1-2
AT2G34430 LHCB1.4, LHB1B1 light-harvesting chlorophyll-p... Potri.005G239200
[exp]
11.48 0.9223 3,Pt-LHB1.1
AT3G54890 LHCA1 photosystem I light harvesting... Potri.008G041000
[exp]
13.30 0.9197 2
AT1G21500 unknown protein Potri.013G128700
[exp]
13.41 0.9106
AT1G30380 PSAK photosystem I subunit K (.1) Potri.006G254200
[exp]
18.54 0.9166 PSAK.2
AT2G28190 CZSOD2, CSD2 copper/zinc superoxide dismuta... Potri.004G216700
[exp]
22.24 0.8670 CSD2.3
AT1G15820 CP24, LHCB6 light harvesting complex photo... Potri.001G210000
[exp]
23.36 0.9106 Pt-LHCB6.2,1
AT3G08940 LHCB4.2 light harvesting complex photo... Potri.006G099500
[exp]
23.95 0.9100 LHCB4.3,Lhcb4
AT5G22460 alpha/beta-Hydrolases superfam... Potri.009G164900
[exp]
25.09 0.9028

Potri.003G220000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.