Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G36130 66 / 3e-15 Cytochrome P450 superfamily protein (.1) AT5G36110 63 / 6e-13 CYP716A1 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) AT3G19270 44 / 2e-06 CYP707A4 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) AT1G78490 41 / 2e-05 CYP708A3 "cytochrome P450, family 708, subfamily A, polypeptide 3", cytochrome P450, family 708, subfamily A, polypeptide 3 (.1) AT5G45340 40 / 8e-05 CYP707A3 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) AT4G19230 39 / 0.0001 CYP707A1 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) AT2G29090 38 / 0.0003 CYP707A2 "cytochrome P450, family 707, subfamily A, polypeptide 2", cytochrome P450, family 707, subfamily A, polypeptide 2 (.1.2) AT3G44970 38 / 0.0004 Cytochrome P450 superfamily protein (.1) AT1G12740 38 / 0.0004 CYP87A2 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) AT2G42850 0 / 1 CYP718 "cytochrome P450, family 718", cytochrome P450, family 718 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G002800 [exp] 90 / 1e-22 AT5G36110 415 / 1e-141 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.011G155600 [exp] 75 / 3e-17 AT5G36110 388 / 4e-131 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.019G078600 [exp] 74 / 6e-17 AT5G36110 476 / 2e-165 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.013G106200 [exp] 74 / 9e-17 AT5G36110 492 / 2e-171 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.018G149300 [exp] 72 / 3e-16 AT5G36110 585 / 0.0 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.006G085500 [exp] 72 / 3e-16 AT5G36110 573 / 0.0 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.007G002400 [exp] 71 / 8e-16 AT5G36110 585 / 0.0 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.018G133901 [exp] 69 / 4e-15 AT5G36110 526 / 0.0 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.001G440200 [exp] 68 / 9e-15 AT5G36110 382 / 6e-129 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010940 [exp] 43 / 8e-06 AT2G42850 571 / 0.0 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) Lus10033308 [exp] 43 / 8e-06 AT5G45340 732 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10037273 [exp] 42 / 9e-06 AT4G19230 461 / 2e-161 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) Lus10019858 [exp] 40 / 5e-05 AT3G19270 643 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10034768 [exp] 40 / 6e-05 AT5G45340 731 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10035685 [exp] 39 / 0.0001 AT4G19230 714 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) Lus10021725 [exp] 39 / 0.0001 AT3G19270 633 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10042652 [exp] 39 / 0.0001 AT3G19270 647 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.003G222001.1 pacid=42787360 polypeptide=Potri.003G222001.1.p locus=Potri.003G222001 ID=Potri.003G222001.1.v4.1 annot-version=v4.1 ATGCTGCCTATGCGTGGTACTTTTAGAGAGGTTTTAGATGATTTCACCTATGCAGGTTATACAATCCCAATACGATGGAAGCTACACTGGAGTCCTGTCT CAACAACTAATGACCCAGTTCTCTTCTCAAATGCAGAAGACTTTGATCACTCCAGGTATGAAGGAGCAGGACACCTGCCCCATATTCGCGTGCTCCATTT GGTGGGGGAGCAAGGATTTGCATGGGGAATGAATACGCTAGACCACAAATACTCGTGTTCCTGCATAATATTGTGA
AA sequence Show only first row Show all	>Potri.003G222001.1 pacid=42787360 polypeptide=Potri.003G222001.1.p locus=Potri.003G222001 ID=Potri.003G222001.1.v4.1 annot-version=v4.1 MLPMRGTFREVLDDFTYAGYTIPIRWKLHWSPVSTTNDPVLFSNAEDFDHSRYEGAGHLPHIRVLHLVGEQGFAWGMNTLDHKYSCSCIIL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G36130			Cytochrome P450 superfamily pr...		Potri.003G222001 [exp]	0	1
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.018G134000 [exp]	5.91	0.8046
AT3G14470			NB-ARC domain-containing disea...		Potri.001G022800 [exp]	6.63	0.8206
AT1G20180			Protein of unknown function (D...		Potri.002G067300 [exp]	7.74	0.7890
AT4G02270		RHS13	root hair specific 13 (.1)		Potri.017G145800 [exp]	8.00	0.8423
AT4G33880	bHLH	RSL2, bHLH085	ROOT HAIR DEFECTIVE 6-LIKE 2 (...		Potri.002G119200 [exp]	13.03	0.7810
AT4G35160			O-methyltransferase family pro...		Potri.009G139700 [exp]	16.79	0.8223
AT1G02170		AtMCP1b, ATMC1,...	LSD ONE LIKE 3, ARABIDOPSIS TH...		Potri.017G053100 [exp]	17.46	0.8181
AT1G29050		TBL38	TRICHOME BIREFRINGENCE-LIKE 38...		Potri.003G201600 [exp]	18.54	0.7989
AT1G06137			unknown protein		Potri.001G380300 [exp]	22.13	0.6541
AT3G61430		ATPIP1, PIP1;1,...	PLASMA MEMBRANE INTRINSIC PROT...		Potri.004G167000 [exp]	23.49	0.8099

Compare expression of checked genes

Potri.003G222001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.