Potri.004G001600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G01435 168 / 4e-55 Expressed protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003331 182 / 9e-61 AT3G01435 175 / 6e-58 Expressed protein (.1)
Lus10022634 179 / 2e-59 AT3G01435 174 / 8e-58 Expressed protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10280 Med11 Mediator complex protein
Representative CDS sequence
>Potri.004G001600.1 pacid=42795254 polypeptide=Potri.004G001600.1.p locus=Potri.004G001600 ID=Potri.004G001600.1.v4.1 annot-version=v4.1
ATGGATTCCCAGACGCAAAACACATCTCTGCAGCGCCTTCAAAACGTCGAAAAGACAGTGGTTAGGGTTTTGGAGGTAGCAGGAGCAGTAATGGATGAGC
TTTCAAATCCAACAGGTCCTCGAAAAGAATTCATCAACAATCATTGCCGTGACTTCATGCAAATGATCAAGGATATTCAGTTTACTTTGAGGAATGAAAT
AAAAAGTGCTTGTGAGTATCGTCCCTTCGAGAAGAGTGATTACACTTGTAGAATCTCTAATGAAATCTGTCTCAGCAAATTGGAACACATCCTTTCTCAA
TTGGATCTCATCACCCAAACTATCACTCCTCAATACCACCATGCCCATGATTCTACTGCTTCTTCTGCTTCCTCTCCCATGGATTTCTAG
AA sequence
>Potri.004G001600.1 pacid=42795254 polypeptide=Potri.004G001600.1.p locus=Potri.004G001600 ID=Potri.004G001600.1.v4.1 annot-version=v4.1
MDSQTQNTSLQRLQNVEKTVVRVLEVAGAVMDELSNPTGPRKEFINNHCRDFMQMIKDIQFTLRNEIKSACEYRPFEKSDYTCRISNEICLSKLEHILSQ
LDLITQTITPQYHHAHDSTASSASSPMDF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G01435 Expressed protein (.1) Potri.004G001600 0 1
AT1G33970 P-loop containing nucleoside t... Potri.019G077300 2.00 0.8806
Potri.001G247000 2.23 0.9095
AT1G73350 unknown protein Potri.004G066700 10.00 0.7895
AT2G45880 BZR BAM7, BMY4 BETA-AMYLASE 4, beta-amylase 7... Potri.001G372500 10.48 0.8240
AT1G01230 ORMDL family protein (.1) Potri.002G174400 10.67 0.8513
AT1G66590 ATCOX19-1 A. THALIANA CYTOCHROME C OXIDA... Potri.001G187200 11.48 0.8196
AT5G13340 unknown protein Potri.019G001900 15.87 0.8061
AT1G07080 Thioredoxin superfamily protei... Potri.006G103000 17.74 0.7600
Potri.010G058400 19.49 0.7219
AT4G09570 CPK4, ATCPK4 calcium-dependent protein kina... Potri.019G083200 20.44 0.7947

Potri.004G001600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.