Potri.004G002800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G05000 287 / 1e-99 AtPFA-DSP1 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
AT4G03960 279 / 1e-96 AtPFA-DSP4 plant and fungi atypical dual-specificity phosphatase 4, Phosphotyrosine protein phosphatases superfamily protein (.1)
AT2G32960 253 / 3e-85 AtPFA-DSP2 plant and fungi atypical dual-specificity phosphatase 2, Phosphotyrosine protein phosphatases superfamily protein (.1)
AT3G02800 209 / 5e-69 AtPFA-DSP3 plant and fungi atypical dual-specificity phosphatase 3, Tyrosine phosphatase family protein (.1)
AT5G16480 200 / 3e-65 AtPFA-DSP5 plant and fungi atypical dual-specificity phosphatase 5, Phosphotyrosine protein phosphatases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G021100 306 / 4e-107 AT4G03960 288 / 4e-100 plant and fungi atypical dual-specificity phosphatase 4, Phosphotyrosine protein phosphatases superfamily protein (.1)
Potri.014G159100 294 / 4e-102 AT1G05000 310 / 3e-108 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Potri.002G224000 290 / 7e-101 AT1G05000 300 / 9e-105 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Potri.013G086500 211 / 2e-69 AT3G02800 296 / 2e-103 plant and fungi atypical dual-specificity phosphatase 3, Tyrosine phosphatase family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031529 289 / 2e-100 AT1G05000 304 / 2e-106 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Lus10035333 284 / 5e-98 AT1G05000 291 / 2e-100 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Lus10029991 280 / 2e-96 AT1G05000 296 / 1e-102 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
Lus10015154 280 / 2e-96 AT1G05000 298 / 3e-103 plant and fungi atypical dual-specificity phosphatase 1, Phosphotyrosine protein phosphatases superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0031 Phosphatase PF03162 Y_phosphatase2 Tyrosine phosphatase family
Representative CDS sequence
>Potri.004G002800.1 pacid=42795762 polypeptide=Potri.004G002800.1.p locus=Potri.004G002800 ID=Potri.004G002800.1.v4.1 annot-version=v4.1
ATGAGAGTTGGTAGCAGGAGTGATTTAGGAGGGGGGGAGAGAGGGAGTCTGATTGAGGTCTCGCCGGCAGATAATAATCGGCCGGCCATGGGAGAGGAGA
GGGAGGGAGAAGAAGAGCTGTTGGTGCCACCGCTGAATTTTGCGATGGTGGATAATGGAATATTTAGGTCGGGTTTCCCTGATTCTGCTAATTTCAGCTT
CTTGCAATCCCTAGGTCTACGTTCCATTCTATATTTGTGCCCAGAACCATATCCAGAAGCAAATTATGAGTTCTTGAAGGATAATGGAATTCGGATTTTT
CAGTTTGGAATTGAAATGTGCAAGGAATCTTTTGCAAACATTCCAGAGGAAACAATCCGCGAAGCATTGAAAGTAATCCTTGATGTAAAGAATCACCCTG
TCTTAGTTCATTGCAAGCGAGGAAAGCATCGTACTGGATGCCTTGTGGGATGTTTGAGAAAGTTGCAAAGATGGTGCTTGTCATCTATATTTGATGAATA
CCAGAGATACGCAGCAGCCAAGGCTAGAGTGTCAGATCAGAGGTTTATGGAGTTGTTTGACATTTCAAGCTTTAAGAATTTACCATTGTCCTTTTCCTCA
ACCAGATCTTCTGCAAACAGATAA
AA sequence
>Potri.004G002800.1 pacid=42795762 polypeptide=Potri.004G002800.1.p locus=Potri.004G002800 ID=Potri.004G002800.1.v4.1 annot-version=v4.1
MRVGSRSDLGGGERGSLIEVSPADNNRPAMGEEREGEEELLVPPLNFAMVDNGIFRSGFPDSANFSFLQSLGLRSILYLCPEPYPEANYEFLKDNGIRIF
QFGIEMCKESFANIPEETIREALKVILDVKNHPVLVHCKRGKHRTGCLVGCLRKLQRWCLSSIFDEYQRYAAAKARVSDQRFMELFDISSFKNLPLSFSS
TRSSANR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G05000 AtPFA-DSP1 plant and fungi atypical dual-... Potri.004G002800 0 1
AT5G11580 Regulator of chromosome conden... Potri.018G044400 1.73 0.8875
AT4G35040 bZIP bZIP19 Basic-leucine zipper (bZIP) tr... Potri.004G175200 2.44 0.8885
AT4G12710 ARM repeat superfamily protein... Potri.014G170100 4.58 0.8837
AT3G25470 bacterial hemolysin-related (.... Potri.014G175500 5.47 0.9142
AT1G62600 Flavin-binding monooxygenase f... Potri.001G121100 12.84 0.8538
AT2G45830 DTA2 downstream target of AGL15 2 (... Potri.014G081600 15.42 0.8623
AT5G46030 unknown protein Potri.011G097300 15.74 0.8557
AT3G29290 EMB2076 embryo defective 2076, Pentatr... Potri.017G090500 15.87 0.8745
AT5G22660 FBD, F-box, Skp2-like and Leuc... Potri.001G337200 19.59 0.8586
AT1G68810 bHLH bHLH030 basic helix-loop-helix (bHLH) ... Potri.019G089000 20.61 0.8581

Potri.004G002800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.