Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-CHRC.3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G22240 380 / 1e-132 Plastid-lipid associated protein PAP / fibrillin family protein (.1) AT4G04020 370 / 1e-128 FIB fibrillin (.1) AT2G35490 229 / 2e-72 Plastid-lipid associated protein PAP / fibrillin family protein (.1) AT5G09820 55 / 1e-08 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2) AT3G26070 47 / 5e-06 Plastid-lipid associated protein PAP / fibrillin family protein (.1) AT1G51110 47 / 7e-06 Plastid-lipid associated protein PAP / fibrillin family protein (.1) AT2G46910 46 / 1e-05 Plastid-lipid associated protein PAP / fibrillin family protein (.1) AT3G23400 43 / 0.0002 FIB4 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1) AT3G26080 42 / 0.0003 plastid-lipid associated protein PAP / fibrillin family protein (.1) AT2G42130 40 / 0.0007 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G137900 [exp] 256 / 5e-83 AT2G35490 301 / 3e-100 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.003G095900 [exp] 253 / 6e-82 AT2G35490 334 / 5e-113 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.001G309300 [exp] 65 / 1e-11 AT5G09820 268 / 7e-90 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2) Potri.003G020700 [exp] 56 / 1e-08 AT3G26070 244 / 6e-81 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.001G209600 [exp] 55 / 1e-08 AT3G26070 253 / 7e-85 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.002G183700 [exp] 46 / 2e-05 AT2G46910 366 / 2e-128 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.001G011700 [exp] 45 / 6e-05 AT1G51110 532 / 0.0 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Potri.016G045900 [exp] 44 / 6e-05 AT2G42130 366 / 1e-127 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5) Potri.006G192200 [exp] 44 / 7e-05 AT2G42130 361 / 1e-125 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001099 [exp] 366 / 6e-127 AT4G22240 362 / 5e-126 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10014790 [exp] 365 / 1e-126 AT4G22240 363 / 2e-126 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10035384 [exp] 229 / 1e-72 AT2G35490 357 / 5e-122 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10030987 [exp] 226 / 1e-71 AT2G35490 354 / 5e-121 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10033514 [exp] 71 / 7e-14 AT5G09820 270 / 3e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2) Lus10020860 [exp] 71 / 8e-14 AT5G09820 269 / 5e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2) Lus10010444 [exp] 61 / 4e-10 AT1G51110 490 / 2e-173 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10020982 [exp] 56 / 9e-09 AT3G26070 265 / 1e-89 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10012100 [exp] 53 / 1e-07 AT1G51110 511 / 0.0 Plastid-lipid associated protein PAP / fibrillin family protein (.1) Lus10012003 [exp] 46 / 2e-05 AT2G42130 383 / 3e-134 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04755 [poplar] [flax] PAP_fibrillin PAP_fibrillin
Representative CDS sequence Show only first row Show all	>Potri.004G003200.1 pacid=42796328 polypeptide=Potri.004G003200.1.p locus=Potri.004G003200 ID=Potri.004G003200.1.v4.1 annot-version=v4.1 ATGGCAGCCATCTCTCAATTAAATCAATTTCCATGCAAGACTCTCTCTTCAAAAACACCTCTATTCTCCCACTTTACTTCTTCAAGACCCTCGATTATCC CTCTAAACTCGATCAAGAACAACCCAACAACCAACAATTCGATCTTGAAACCAAGAATTCTAGTAACCAGAGAACAACCCACCAAGAAAAGGAATCTTTT CTTGGTTAAGGCTGTGGATGAGGACGAGGGGAGTCCAGAAAATGAAGGCCCTCCGGTTGCTTTGGCTGAGAAGGGGGAGGAGGAGCTGAAAGAGCTGGCA GAGGTTGATCGCTTGAAGGGACAGCTGGTGGATACTTTTTATGGGACTGATCGTGGACTGAATGCTACCAGTGAGACTAGAGCTGAGGTTGTGGAGCTTA TTACTCAGCTTGAAGCCAGAAACCCCAATCCTGCTCCCACTGAGGCCTTGACTCTGCTCAATGGCAAATGGATTCTTGCATACACATCTTTTGCGGGCTT GTTCCCATTGCTGTCAAGGGGTACATTGCCATTGGTAAAGGTTGAGGAAATATCTCAGACGATCGACTCGGAGAACTTAACTGTCCAGAATTCTGTGCAA TTCTCAGGGCCGCTGGCTACTACATCCATTAGTACCAATGCCAAATTTGAAGTCCGAAGCCCCAAGCGTGTGCAGATCAAGTTTGAAGAAGGCATTATTG GGACTCCCAAGCTGACAGACTCAATAGAGTTACCGGAAAATGTGGAATTTCTGGGACAAAAGATCGACCTCACACCCTTCAGAGGCATAATCTCCTCTGT GCAGGATACAGCCTCATCTGTTGCAAAGACCATTTCCAGCCAACCACCATTGAAGTTTTCTATCTCAAACAGGAATGCTGAATCATGGTTGCTAACCACA TACCTTGACGATGACCTTCGGATTTCAAGAGGTGATGCTGGCAGTATATTTGTGCTCATTAAGGAAGGCAGTCCCCTCTTGACACCCTGA
AA sequence Show only first row Show all	>Potri.004G003200.1 pacid=42796328 polypeptide=Potri.004G003200.1.p locus=Potri.004G003200 ID=Potri.004G003200.1.v4.1 annot-version=v4.1 MAAISQLNQFPCKTLSSKTPLFSHFTSSRPSIIPLNSIKNNPTTNNSILKPRILVTREQPTKKRNLFLVKAVDEDEGSPENEGPPVALAEKGEEELKELA EVDRLKGQLVDTFYGTDRGLNATSETRAEVVELITQLEARNPNPAPTEALTLLNGKWILAYTSFAGLFPLLSRGTLPLVKVEEISQTIDSENLTVQNSVQ FSGPLATTSISTNAKFEVRSPKRVQIKFEEGIIGTPKLTDSIELPENVEFLGQKIDLTPFRGIISSVQDTASSVAKTISSQPPLKFSISNRNAESWLLTT YLDDDLRISRGDAGSIFVLIKEGSPLLTP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G22240			Plastid-lipid associated prote...		Potri.004G003200 [exp]	0	1	Pt-CHRC.3
AT2G32540		ATCSLB4, ATCSLB...	CELLULOSE SYNTHASE LIKE B4, ce...		Potri.002G227300 [exp]	1.00	0.9800	ATCSLB05.1
AT5G38260			Protein kinase superfamily pro...		Potri.007G125800 [exp]	3.00	0.9686
AT4G22260		IM1, IM	IMMUTANS, Alternative oxidase ...		Potri.004G002600 [exp]	3.60	0.9589
AT2G37240			Thioredoxin superfamily protei...		Potri.006G133100 [exp]	5.65	0.9710
AT4G24000		ATCSLG2	ARABIDOPSIS THALIANA CELLULOSE...		Potri.010G074800 [exp]	6.00	0.9630
AT1G10830		Z-ISO1.2, Z-ISO...	15-cis-zeta-carotene isomerase...		Potri.014G146900 [exp]	6.32	0.9680
AT1G54740			Protein of unknown function (D...		Potri.005G037600 [exp]	6.32	0.9518
AT2G31220	bHLH	bHLH010	basic helix-loop-helix (bHLH) ...		Potri.006G202100 [exp]	7.07	0.9618
AT4G22260		IM1, IM	IMMUTANS, Alternative oxidase ...		Potri.011G021800 [exp]	8.00	0.9650
AT4G16330			2-oxoglutarate (2OG) and Fe(II...		Potri.011G024100 [exp]	8.24	0.9527

Compare expression of checked genes

Potri.004G003200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.